hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080809/iprscan-20080809-23402789/chunk_1/iprscan-20080809-23402789.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh19857 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01251.8.fs Ribosomal protein S7e 121.7 9.5e-34 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01251.8.fs 1/1 10 61 .. 117 168 .. 121.7 9.5e-34 Alignments of top-scoring domains: PF01251.8.fs: domain 1 of 1, from 10 to 61: score 121.7, E = 9.5e-34 *->SRtLTaVhdaILEDLVFPtEIVGKRiRvklDGskliKVhLDkkdqnt SRtLTaVhdaILEDLVFP+EIVGKRiRvklDGs+liKVhLDk++qn+ fh19857 10 SRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNN 56 ieyKv<-* +e+Kv fh19857 57 VEHKV 61 //