hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20080809/iprscan-20080809-23473338/chunk_1/iprscan-20080809-23473338.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fh20087
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00096.16.ls Zinc finger, C2H2 type                         117.6    3.3e-32   4
PF00096.16.fs Zinc finger, C2H2 type                         110.8    3.6e-30   6
PF01352.17.fs KRAB box                                        84.2    2.8e-23   1
PF01352.17.ls KRAB box                                        86.2    9.2e-23   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF01352.17.fs   1/1      50    90 ..     1    41 []    84.2  2.8e-23
PF01352.17.ls   1/1      50    90 ..     1    41 []    86.2  9.2e-23
PF00096.16.ls   1/4     263   285 ..     1    24 []    31.9    2e-06
PF00096.16.fs   3/6     263   285 ..     1    24 []    30.0  3.2e-06
PF00096.16.ls   2/4     291   313 ..     1    24 []    26.1  0.00011
PF00096.16.fs   4/6     291   313 ..     1    24 []    24.2  8.9e-05
PF00096.16.fs   5/6     319   341 ..     1    24 []    23.9  0.00011
PF00096.16.ls   3/4     319   341 ..     1    24 []    25.8  0.00014
PF00096.16.fs   6/6     347   369 ..     1    24 []    31.7  1.2e-06
PF00096.16.ls   4/4     347   369 ..     1    24 []    33.7    6e-07

Alignments of top-scoring domains:
PF01352.17.fs: domain 1 of 1, from 50 to 90: score 84.2, E = 2.8e-23
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      VtFeDVaV Ft+ EW++L+ +QrnLY++VMlEN +nLvSl    
     fh20087    50    VTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVSLA    90   

PF01352.17.ls: domain 1 of 1, from 50 to 90: score 86.2, E = 9.2e-23
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      VtFeDVaV Ft+ EW++L+ +QrnLY++VMlEN +nLvSl    
     fh20087    50    VTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVSLA    90   

PF00096.16.ls: domain 1 of 4, from 263 to 285: score 31.9, E = 2e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                       +C  +Cg+ Fsrks+L  H+rtH   
     fh20087   263    QVCR-ECGRGFSRKSQLIIHQRTH    285  

PF00096.16.fs: domain 3 of 6, from 263 to 285: score 30.0, E = 3.2e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                       +C  +Cg+ Fsrks+L  H+rtH   
     fh20087   263    QVCR-ECGRGFSRKSQLIIHQRTH    285  

PF00096.16.ls: domain 2 of 4, from 291 to 313: score 26.1, E = 0.00011
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C  +Cg+ F   s L++Hl tH   
     fh20087   291    YVCG-ECGRGFIVESVLRNHLSTH    313  

PF00096.16.fs: domain 4 of 6, from 291 to 313: score 24.2, E = 8.9e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C  +Cg+ F   s L++Hl tH   
     fh20087   291    YVCG-ECGRGFIVESVLRNHLSTH    313  

PF00096.16.fs: domain 5 of 6, from 319 to 341: score 23.9, E = 0.00011
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C+ +Cg+ Fs k  L rH+rtH   
     fh20087   319    YVCS-HCGRGFSCKPYLIRHQRTH    341  

PF00096.16.ls: domain 3 of 4, from 319 to 341: score 25.8, E = 0.00014
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C+ +Cg+ Fs k  L rH+rtH   
     fh20087   319    YVCS-HCGRGFSCKPYLIRHQRTH    341  

PF00096.16.fs: domain 6 of 6, from 347 to 369: score 31.7, E = 1.2e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C+ +Cg+ F+ ks+L +H+r+H   
     fh20087   347    FMCT-VCGRGFREKSELIKHQRIH    369  

PF00096.16.ls: domain 4 of 4, from 347 to 369: score 33.7, E = 6e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C+ +Cg+ F+ ks+L +H+r+H   
     fh20087   347    FMCT-VCGRGFREKSELIKHQRIH    369  

//