hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-00315611/chunk_1/iprscan-20080810-00315611.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh20918 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00276 219.1 3.8e-61 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00276 1/1 124 256 .. 1 138 [] 219.1 3.8e-61 Alignments of top-scoring domains: SM00276: domain 1 of 1, from 124 to 256: score 219.1, E = 3.8e-61 *->vPykstlpgglkpGqtltvkGivtpdanqkrFsiNLltgengdiaLH vPy+++lpgg+ p++ +t+ G+v+p+a +r++++++ g +d+a+H fh20918 124 VPYNLPLPGGVVPRMLITILGTVKPNA--NRIALDFQRG--NDVAFH 166 fNpRFdehgdvgtvVcNSlensGsWGsEeReggfPFqkGqeFdltIivqp fNpRF+e ++++++VcN++++ ++WG+EeR ++fPF++G++F +++ v+p fh20918 167 FNPRFNE-NNRRVIVCNTKLD-NNWGREERQSVFPFESGKPFKIQVLVEP 214 dkFqIfvNgghfaeFpHRlples.idylsinGDvqltsvsle<-* d+F+++vN++h+++++HR++ +++i l+i+GD+ lts s++ fh20918 215 DHFKVAVNDAHLLQYNHRVKKLNeISKLGISGDIDLTSASYT 256 //