hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-01232204/chunk_1/iprscan-20080810-01232204.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh21945 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00745 111.0 1.4e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00745 1/1 74 151 .. 1 81 [] 111.0 1.4e-28 Alignments of top-scoring domains: SM00745: domain 1 of 1, from 74 to 151: score 111.0, E = 1.4e-28 *->trdylqkAieliskAlkaDedvagdyeeAlelYkkgieyLlqgikve +rdyl A+++i +Al+ D ++dye+A+++Y++g+++Ll+gi+v+ fh21945 74 KRDYLVDAATQIRLALERDV--SEDYEAAFNHYQNGVDVLLRGIHVD 118 kpsekrrealkakareYldRAeeikkylderlkp<-* p+++rrea+k k+++Yl+RAeei +++++rl fh21945 119 -PNKERREAVKLKITKYLRRAEEIFNCHLQRLLS 151 //