hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-02152462/chunk_1/iprscan-20080810-02152462.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh22923 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.ls Helix-loop-helix DNA-binding domain 76.4 8.5e-20 1 PF00010.16.fs Helix-loop-helix DNA-binding domain 74.4 2.4e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 249 301 .. 1 53 [] 74.4 2.4e-19 PF00010.16.ls 1/1 249 301 .. 1 53 [] 76.4 8.5e-20 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 249 to 301: score 74.4, E = 2.4e-19 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR +narER R++ i afe+Lr+ +P+ ++++KlsK++iLr A++ fh22923 249 RRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACN 295 YIksLq<-* YI sL fh22923 296 YILSLA 301 PF00010.16.ls: domain 1 of 1, from 249 to 301: score 76.4, E = 8.5e-20 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve rR +narER R++ i afe+Lr+ +P+ ++++KlsK++iLr A++ fh22923 249 RRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACN 295 YIksLq<-* YI sL fh22923 296 YILSLA 301 //