hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-02404999/chunk_1/iprscan-20080810-02404999.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh23250 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07690.6.fs Major Facilitator Superfamily 129.8 2.9e-36 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07690.6.fs 1/1 132 335 .. 1 233 [. 129.8 2.9e-36 Alignments of top-scoring domains: PF07690.6.fs: domain 1 of 1, from 132 to 335: score 129.8, E = 2.9e-36 *->lflaaflaglgrsllgpalpylassleesslgqtdllspteiglllt l+ +++l++++r++++++lp + + ++ + + gl+ t fh23250 132 LCYINLLNYMDRFTVAGVLPDIE---QF--FN----IGDSSSGLIQT 169 afalgyalaqplaGrlsDrfGrrvyirlkpvlllglllfalgslllafas +f y +++p++G+l+Dr++r+ + ++ g+++++l +l + f++ fh23250 170 VFISSYMVLAPVFGYLGDRYNRK---Y---LMCGGIAFWSLVTLGSSFIP 213 stslwllliarallqGlgagllapaaaaliadwfppeergralgivsagf ++wlll++r l G+g++++ + a +liad+f ++r+r+l+i++ ++ fh23250 214 GEHFWLLLLTRGL-VGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAI 262 glGaalggpllggllaalgwwwssgtfWraaFlilgilallaallllvlf ++G+ +g ++g+ + + + W++a + +l+++a+ll +++ fh23250 263 PVGSG-LGYIAGSKVKDMAGD------WHWALRVTPGLGVVAVLL--LFL 303 llpeppakasgkpeeeeagialr.lll.p.lllillalf<-* +++epp+ a ++ + ++l++ + +++l al+ fh23250 304 VVREPPRGAVERH-------SDLpPLNpTsWWADLRALA 335 //