hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-03224228/chunk_1/iprscan-20080810-03224228.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fh24387 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF03736.7.ls EPTP domain 171.8 1.6e-48 2 PF03736.7.fs EPTP domain 168.0 2.3e-47 2 PF01463.14.fs Leucine rich repeat C-terminal domain 14.4 0.0016 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01463.14.fs 1/1 34 59 .. 1 26 [] 14.4 0.0016 PF03736.7.fs 1/2 63 103 .. 1 44 [] 74.6 3e-19 PF03736.7.ls 1/2 63 103 .. 1 44 [] 76.5 7.9e-20 PF03736.7.fs 2/2 257 298 .. 1 44 [] 93.4 6.3e-25 PF03736.7.ls 2/2 257 298 .. 1 44 [] 95.3 1.6e-25 Alignments of top-scoring domains: PF01463.14.fs: domain 1 of 1, from 34 to 59: score 14.4, E = 0.0016 *->dlrCasPeslrGqplldlppsdfsCp<-* d++C++P++++ + + +l ++df+C fh24387 34 DIYCEGPPEYKKRKINSLSSKDFDCI 59 PF03736.7.fs: domain 1 of 2, from 63 to 103: score 74.6, E = 3e-19 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* F+++qdlP +++l++++Fs+ +D+Y+++aqp+++ ++++l+Wd fh24387 63 FAKSQDLP--YQSLSIDTFSYLNDEYVVIAQPFTG-KCIFLEWD 103 PF03736.7.ls: domain 1 of 2, from 63 to 103: score 76.5, E = 7.9e-20 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* F+++qdlP +++l++++Fs+ +D+Y+++aqp+++ ++++l+Wd fh24387 63 FAKSQDLP--YQSLSIDTFSYLNDEYVVIAQPFTG-KCIFLEWD 103 PF03736.7.fs: domain 2 of 2, from 257 to 298: score 93.4, E = 6.3e-25 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* F++++d+Pn+edv+avkhFs++gDvY++L+++ig dS+v++W+ fh24387 257 FTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIG--DSKVMKWG 298 PF03736.7.ls: domain 2 of 2, from 257 to 298: score 95.3, E = 1.6e-25 *->FvlhqdlPnvedvlavkhFsaggDvYLaLaqpigrldSlvlrWd<-* F++++d+Pn+edv+avkhFs++gDvY++L+++ig dS+v++W+ fh24387 257 FTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIG--DSKVMKWG 298 //