hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-09074995/chunk_1/iprscan-20090618-09074995.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fj00071s1
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00096.16.ls Zinc finger, C2H2 type                         218.1    1.9e-62   8
PF00096.16.fs Zinc finger, C2H2 type                         206.8    4.6e-59   9
PF01352.17.fs KRAB box                                        61.3    9.9e-17   1
PF01352.17.ls KRAB box                                        63.3    7.1e-16   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF01352.17.fs   1/1     230   270 ..     1    41 []    61.3  9.9e-17
PF01352.17.ls   1/1     230   270 ..     1    41 []    63.3  7.1e-16
PF00096.16.ls   2/8     485   507 ..     1    24 []    20.8   0.0044
PF00096.16.ls   3/8     514   536 ..     1    24 []    30.6  5.2e-06
PF00096.16.fs   4/9     514   536 ..     1    24 []    28.6    7e-06
PF00096.16.ls   4/8     542   564 ..     1    24 []    27.0  6.1e-05
PF00096.16.fs   5/9     542   564 ..     1    24 []    25.0  5.4e-05
PF00096.16.ls   5/8     570   592 ..     1    24 []    28.0  3.1e-05
PF00096.16.fs   6/9     570   592 ..     1    24 []    26.0  3.1e-05
PF00096.16.ls   6/8     598   620 ..     1    24 []    29.2  1.4e-05
PF00096.16.fs   7/9     598   620 ..     1    24 []    27.2  1.6e-05
PF00096.16.ls   7/8     626   648 ..     1    24 []    34.2  4.3e-07
PF00096.16.fs   8/9     626   648 ..     1    24 []    32.2    9e-07
PF00096.16.ls   8/8     654   677 ..     1    24 []    33.5    7e-07
PF00096.16.fs   9/9     654   677 ..     1    24 []    31.5  1.3e-06

Alignments of top-scoring domains:
PF01352.17.fs: domain 1 of 1, from 230 to 270: score 61.3, E = 9.9e-17
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      V+F DV ++F+  EWe L+++Q++LY+++M  Ny+ L+S++   
   fj00071s1   230    VAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLISMD    270  

PF01352.17.ls: domain 1 of 1, from 230 to 270: score 63.3, E = 7.1e-16
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      V+F DV ++F+  EWe L+++Q++LY+++M  Ny+ L+S++   
   fj00071s1   230    VAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLISMD    270  

PF00096.16.ls: domain 2 of 8, from 485 to 507: score 20.8, E = 0.0044
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                       +Cp +C ++F+++s L+ Hlr+H   
   fj00071s1   485    PTCP-HCARTFTHPSRLTYHLRVH    507  

PF00096.16.ls: domain 3 of 8, from 514 to 536: score 30.6, E = 5.2e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      + Cp dC k+F +++ L++H+r H   
   fj00071s1   514    FPCP-DCPKRFADQARLTSHRRAH    536  

PF00096.16.fs: domain 4 of 9, from 514 to 536: score 28.6, E = 7e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      + Cp dC k+F +++ L++H+r H   
   fj00071s1   514    FPCP-DCPKRFADQARLTSHRRAH    536  

PF00096.16.ls: domain 4 of 8, from 542 to 564: score 27.0, E = 6.1e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C  +Cg+sFs k +L  H+r H   
   fj00071s1   542    FRCA-QCGRSFSLKISLLLHQRGH    564  

PF00096.16.fs: domain 5 of 9, from 542 to 564: score 25.0, E = 5.4e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C  +Cg+sFs k +L  H+r H   
   fj00071s1   542    FRCA-QCGRSFSLKISLLLHQRGH    564  

PF00096.16.ls: domain 5 of 8, from 570 to 592: score 28.0, E = 3.1e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++Cp +Cg  F+ +s L rH+++H   
   fj00071s1   570    FSCP-QCGIDFNGHSALIRHQMIH    592  

PF00096.16.fs: domain 6 of 9, from 570 to 592: score 26.0, E = 3.1e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++Cp +Cg  F+ +s L rH+++H   
   fj00071s1   570    FSCP-QCGIDFNGHSALIRHQMIH    592  

PF00096.16.ls: domain 6 of 8, from 598 to 620: score 29.2, E = 1.4e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y C+ dC ksF rk++L +H+r H   
   fj00071s1   598    YPCT-DCSKSFMRKEHLLNHRRLH    620  

PF00096.16.fs: domain 7 of 9, from 598 to 620: score 27.2, E = 1.6e-05
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y C+ dC ksF rk++L +H+r H   
   fj00071s1   598    YPCT-DCSKSFMRKEHLLNHRRLH    620  

PF00096.16.ls: domain 7 of 8, from 626 to 648: score 34.2, E = 4.3e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++Cp +CgksF rk++L +H+r+H   
   fj00071s1   626    FSCP-HCGKSFIRKHHLMKHQRIH    648  

PF00096.16.fs: domain 8 of 9, from 626 to 648: score 32.2, E = 9e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++Cp +CgksF rk++L +H+r+H   
   fj00071s1   626    FSCP-HCGKSFIRKHHLMKHQRIH    648  

PF00096.16.ls: domain 8 of 8, from 654 to 677: score 33.5, E = 7e-07
                   *->ykCpfdCgksFsrksnLkrHlrt.H<-*
                      y C+ +Cg+sF+ k +Lk Hlr++H   
   fj00071s1   654    YPCS-YCGRSFRYKQTLKDHLRSgH    677  

PF00096.16.fs: domain 9 of 9, from 654 to 677: score 31.5, E = 1.3e-06
                   *->ykCpfdCgksFsrksnLkrHlrt.H<-*
                      y C+ +Cg+sF+ k +Lk Hlr++H   
   fj00071s1   654    YPCS-YCGRSFRYKQTLKDHLRSgH    677  

//