hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-14400357/chunk_1/iprscan-20090525-14400357.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj00449 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08927.1.fs Domain of unknown function (DUF1909) 89.8 2.2e-30 1 PF08927.1.ls Domain of unknown function (DUF1909) 91.8 2e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08927.1.fs 1/1 43 113 .. 1 74 [] 89.8 2.2e-30 PF08927.1.ls 1/1 43 113 .. 1 74 [] 91.8 2e-24 Alignments of top-scoring domains: PF08927.1.fs: domain 1 of 1, from 43 to 113: score 89.8, E = 2.2e-30 *->GNGaKaqqkReRnaKkaakkgkkSQadqlKanekAlniqCkvCrqtF ++G++++q++++naKk+a+ +kk++ dq+ a+++Al +C vCr+++ fj00449 43 ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQM 89 lcTvrepaLkeHaenKHpKsdleeCFP<-* + +++++k+H+e+KHpK++l+++++ fj00449 90 P---DPKTFKQHFESKHPKTPLPPELA 113 PF08927.1.ls: domain 1 of 1, from 43 to 113: score 91.8, E = 2e-24 *->GNGaKaqqkReRnaKkaakkgkkSQadqlKanekAlniqCkvCrqtF ++G++++q++++naKk+a+ +kk++ dq+ a+++Al +C vCr+++ fj00449 43 ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQM 89 lcTvrepaLkeHaenKHpKsdleeCFP<-* + +++++k+H+e+KHpK++l+++++ fj00449 90 P---DPKTFKQHFESKHPKTPLPPELA 113 //