hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-05084656/chunk_1/iprscan-20080810-05084656.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj00939 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00157.8.ls Pou domain - N-terminal to homeobox domain 190.5 3.7e-54 1 PF00157.8.fs Pou domain - N-terminal to homeobox domain 188.6 1.4e-53 1 PF00046.19.ls Homeobox domain 87.0 5.3e-23 1 PF00046.19.fs Homeobox domain 85.0 2.1e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00157.8.fs 1/1 330 404 .. 1 78 [] 188.6 1.4e-53 PF00157.8.ls 1/1 330 404 .. 1 78 [] 190.5 3.7e-54 PF00046.19.fs 1/1 430 486 .. 1 57 [] 85.0 2.1e-22 PF00046.19.ls 1/1 430 486 .. 1 57 [] 87.0 5.3e-23 Alignments of top-scoring domains: PF00157.8.fs: domain 1 of 1, from 330 to 404: score 188.6, E = 1.4e-53 *->deatdleeLEkFAkeFKqRRIkLGyTQadVGlALgalygPGvnafSQ +e+ dleeLE+FAk+FKqRRIkLG+TQ+dVGlA+g+lyg n+fSQ fj00939 330 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYG---NDFSQ 373 tTICRFEaLqLSfKNmcKLKPlLekWLeeAE<-* tTI+RFEaL+LSfKNmcKLKPlLekWL++AE fj00939 374 TTISRFEALNLSFKNMCKLKPLLEKWLNDAE 404 PF00157.8.ls: domain 1 of 1, from 330 to 404: score 190.5, E = 3.7e-54 *->deatdleeLEkFAkeFKqRRIkLGyTQadVGlALgalygPGvnafSQ +e+ dleeLE+FAk+FKqRRIkLG+TQ+dVGlA+g+lyg n+fSQ fj00939 330 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYG---NDFSQ 373 tTICRFEaLqLSfKNmcKLKPlLekWLeeAE<-* tTI+RFEaL+LSfKNmcKLKPlLekWL++AE fj00939 374 TTISRFEALNLSFKNMCKLKPLLEKWLNDAE 404 PF00046.19.fs: domain 1 of 1, from 430 to 486: score 85.0, E = 2.1e-22 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r+kRT++ ++ + +LEk F +n++P+ ee+ +A++L++++++++vW fj00939 430 RKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVW 476 FQNRRaKwKk<-* F+NRR+K+K+ fj00939 477 FCNRRQKEKR 486 PF00046.19.ls: domain 1 of 1, from 430 to 486: score 87.0, E = 5.3e-23 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r+kRT++ ++ + +LEk F +n++P+ ee+ +A++L++++++++vW fj00939 430 RKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVW 476 FQNRRaKwKk<-* F+NRR+K+K+ fj00939 477 FCNRRQKEKR 486 //