hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-05084656/chunk_1/iprscan-20080810-05084656.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj00939 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00352 190.3 1.9e-52 1 SM00389 81.4 1.1e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00352 1/1 330 404 .. 1 78 [] 190.3 1.9e-52 SM00389 1/1 429 491 .. 1 63 [] 81.4 1.1e-19 Alignments of top-scoring domains: SM00352: domain 1 of 1, from 330 to 404: score 190.3, E = 1.9e-52 *->deatdleeLEkFAkeFKqRRIkLGyTQadVGlALgalygPGvnafSQ +e+ dleeLE+FAk+FKqRRIkLG+TQ+dVGlA+g+lyg n+fSQ fj00939 330 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYG---NDFSQ 373 tTICRFEaLqLSfKNmcKLKPlLekWLeeAE<-* tTI+RFEaL+LSfKNmcKLKPlLekWL++AE fj00939 374 TTISRFEALNLSFKNMCKLKPLLEKWLNDAE 404 SM00389: domain 1 of 1, from 429 to 491: score 81.4, E = 1.1e-19 *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv +r+kRts+ + + +LEk+F +n++P++ee+ +A++L++ +++++v fj00939 429 RRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRV 475 WFQNRRakwkrqekkk<-* WF+NRR+k+kr + ++ fj00939 476 WFCNRRQKEKRINPPS 491 //