hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20090416/iprscan-20090416-15050354/chunk_1/iprscan-20090416-15050354.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fj03263
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00397.16.ls WW domain                                       89.8    7.9e-24   2
PF00397.16.fs WW domain                                       85.8    4.8e-23   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF00397.16.fs   1/2      36    65 ..     1    30 []    50.1  4.8e-13
PF00397.16.ls   1/2      36    65 ..     1    30 []    52.1  1.8e-12
PF00397.16.fs   2/2      83   112 ..     1    30 []    35.7    5e-09
PF00397.16.ls   2/2      83   112 ..     1    30 []    37.7  3.7e-08

Alignments of top-scoring domains:
PF00397.16.fs: domain 1 of 2, from 36 to 65: score 50.1, E = 4.8e-13
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      lp+gWee+ d dG++YY++h ++tT+W++P   
     fj03263    36    LPEGWEEARDFDGKVYYIDHTNRTTSWIDP    65   

PF00397.16.ls: domain 1 of 2, from 36 to 65: score 52.1, E = 1.8e-12
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      lp+gWee+ d dG++YY++h ++tT+W++P   
     fj03263    36    LPEGWEEARDFDGKVYYIDHTNRTTSWIDP    65   

PF00397.16.fs: domain 2 of 2, from 83 to 112: score 35.7, E = 5e-09
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      lp gWee++dp+   Y+++hnTktTq e+P   
     fj03263    83    LPLGWEEAYDPQVGDYFIDHNTKTTQIEDP    112  

PF00397.16.ls: domain 2 of 2, from 83 to 112: score 37.7, E = 3.7e-08
                   *->lppgWeertdpdGrpYYyNhnTktTqWekP<-*
                      lp gWee++dp+   Y+++hnTktTq e+P   
     fj03263    83    LPLGWEEAYDPQVGDYFIDHNTKTTQIEDP    112  

//