hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090416/iprscan-20090416-15050354/chunk_1/iprscan-20090416-15050354.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj03263 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00456 93.7 2.2e-23 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00456 1/2 35 67 .. 1 34 [] 55.0 9.5e-12 SM00456 2/2 82 114 .. 1 34 [] 38.6 8.3e-07 Alignments of top-scoring domains: SM00456: domain 1 of 2, from 35 to 67: score 55.0, E = 9.5e-12 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* plP+gWee+ d d G++YY++h++++t+W +Pr+ fj03263 35 PLPEGWEEARDFD-GKVYYIDHTNRTTSWIDPRD 67 SM00456: domain 2 of 2, from 82 to 114: score 38.6, E = 8.3e-07 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* lP gWee++dp+ Y+++h+Tk+tq e+Pr fj03263 82 ELPLGWEEAYDPQ-VGDYFIDHNTKTTQIEDPRV 114 //