hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-07452120/chunk_1/iprscan-20080810-07452120.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj04618 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00375.9.fs Sodium:dicarboxylate symporter family 201.3 2e-57 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00375.9.fs 1/1 59 199 .. 1 145 [. 201.3 2e-57 Alignments of top-scoring domains: PF00375.9.fs: domain 1 of 1, from 59 to 199: score 201.3, E = 2e-57 *->LvlqiliglvLGillGailrelseklsdkvveylaplGdiFvRlLKM + l++++++v+G l+++lr+++ l +++ +y++++G++++R+L+M fj04618 59 FILLTVSAVVIGVSLAFALRPYQ--LTYRQIKYFSFPGELLMRMLQM 103 IVlPlvissLVtGiAglgDakklGklGgkaiiYfeitTtiAaalGiilan +VlPl++ssLVtG+A+l D k+ G++G++a +Y+++tT+iA+ +Gi+++ fj04618 104 LVLPLIVSSLVTGMASL-DNKATGRMGMRAAVYYMVTTIIAVFIGILMVT 152 viqPGagvlisqlsrggatvdisavdaflDlarnlFPenlvqailsii<- +i+PG+g +++l+r+g i ++daf Dl+rn+FP+nlv+a+++++ fj04618 153 IIHPGKG-SKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQV 199 * fj04618 - - //