hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-08145756/chunk_1/iprscan-20080810-08145756.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj05622 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08499.2.fs 3'5'-cyclic nucleotide phosphodiesterase N 101.1 2.3e-28 1 PF08499.2.ls 3'5'-cyclic nucleotide phosphodiesterase N 103.0 7.9e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08499.2.fs 1/1 131 191 .. 1 63 [] 101.1 2.3e-28 PF08499.2.ls 1/1 131 191 .. 1 63 [] 103.0 7.9e-28 Alignments of top-scoring domains: PF08499.2.fs: domain 1 of 1, from 131 to 191: score 101.1, E = 2.3e-28 *->rLlDeddelsevqsesvpdeaeVreWLastftrqvgtakskseekpk ++lD++del+e++s++vp+e Vr+WLastft+q ++ eekpk fj05622 131 QILDTEDELQELRSDAVPSE--VRDWLASTFTQQARAKGRRAEEKPK 175 frsvanavqagIivek<-* frs+++avqagI+ve+ fj05622 176 FRSIVHAVQAGIFVER 191 PF08499.2.ls: domain 1 of 1, from 131 to 191: score 103.0, E = 7.9e-28 *->rLlDeddelsevqsesvpdeaeVreWLastftrqvgtakskseekpk ++lD++del+e++s++vp+e Vr+WLastft+q ++ eekpk fj05622 131 QILDTEDELQELRSDAVPSE--VRDWLASTFTQQARAKGRRAEEKPK 175 frsvanavqagIivek<-* frs+++avqagI+ve+ fj05622 176 FRSIVHAVQAGIFVER 191 //