hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-08341196/chunk_1/iprscan-20080810-08341196.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj06329 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00413 206.8 1.9e-57 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00413 1/1 322 407 .. 1 90 [] 206.8 1.9e-57 Alignments of top-scoring domains: SM00413: domain 1 of 1, from 322 to 407: score 206.8, E = 1.9e-57 *->qiqLWqFLleLLldpennsdiIrWtdrsgGeFklvdpeeEVARLWGq ++qLWqFL LL+dp+n s++I+Wt+r++ eFkl++pee VAR+WG+ fj06329 322 SLQLWQFLVALLDDPSN-SHFIAWTGRGM-EFKLIEPEE-VARRWGI 365 rKgNkpnMNYeKLSRALRyYYkknIlrKVeGkrlvYkFvkdpl<-* +K N+p+MNY+KLSR+LRyYY+k+I++KV G+r+vYkFv+dp+ fj06329 366 QK-NRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPE 407 //