hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-08592637/chunk_1/iprscan-20080810-08592637.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj06773 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00170.11.fs bZIP transcription factor 52.6 2.8e-14 1 PF00170.11.ls bZIP transcription factor 54.6 3.1e-13 1 PF07716.5.fs Basic region leucine zipper 42.9 9.6e-11 1 PF07716.5.ls Basic region leucine zipper 44.9 2.5e-10 1 PF00096.16.ls Zinc finger, C2H2 type 23.0 0.00096 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00096.16.ls 1/1 29 53 .. 1 24 [] 23.0 0.00096 PF07716.5.fs 1/1 354 408 .. 1 57 [] 42.9 9.6e-11 PF00170.11.ls 1/1 354 418 .. 1 65 [] 54.6 3.1e-13 PF00170.11.fs 1/1 354 418 .. 1 65 [] 52.6 2.8e-14 PF07716.5.ls 1/1 354 408 .. 1 57 [] 44.9 2.5e-10 Alignments of top-scoring domains: PF00096.16.ls: domain 1 of 1, from 29 to 53: score 23.0, E = 0.00096 *->ykCpf.dCgksFsrksnLkrHlrtH<-* + C+ ++Cg++F++ ++L H+ +H fj06773 29 FLCTApGCGQRFTNEDHLAVHKHKH 53 PF07716.5.fs: domain 1 of 1, from 354 to 408: score 42.9, E = 9.6e-11 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk ++de+r++ +rN++AA r+R+K+K + le+++++L N qL fj06773 354 DPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQL-- 398 rqkveqLekE<-* + +v L++E fj06773 399 QSEVTLLRNE 408 PF00170.11.ls: domain 1 of 1, from 354 to 418: score 54.6, E = 3.1e-13 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk +++ Kr + +++NR AA+r+R++++ ++ Le k+e L++ N +L + fj06773 354 DPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQS 400 elerLkkevakLksenee<-* e+ L++eva+Lk+ + fj06773 401 EVTLLRNEVAQLKQLLLA 418 PF00170.11.fs: domain 1 of 1, from 354 to 418: score 52.6, E = 2.8e-14 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk +++ Kr + +++NR AA+r+R++++ ++ Le k+e L++ N +L + fj06773 354 DPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQS 400 elerLkkevakLksenee<-* e+ L++eva+Lk+ + fj06773 401 EVTLLRNEVAQLKQLLLA 418 PF07716.5.ls: domain 1 of 1, from 354 to 408: score 44.9, E = 2.5e-10 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk ++de+r++ +rN++AA r+R+K+K + le+++++L N qL fj06773 354 DPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQL-- 398 rqkveqLekE<-* + +v L++E fj06773 399 QSEVTLLRNE 408 //