hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-08592637/chunk_1/iprscan-20080810-08592637.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj06773 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00338 86.3 3.8e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00338 1/1 354 418 .. 1 65 [] 86.3 3.8e-21 Alignments of top-scoring domains: SM00338: domain 1 of 1, from 354 to 418: score 86.3, E = 3.8e-21 *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk ++deKrr+ +erNR+AA r+R+++k +++ Le+k+e+L++ N +L++ fj06773 354 DPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQS 400 eleqLrreleklkselee<-* e+ +Lr+e+++lk++l + fj06773 401 EVTLLRNEVAQLKQLLLA 418 //