hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-09430517/chunk_1/iprscan-20080810-09430517.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj08031 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 106.8 6e-29 1 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 104.8 1.2e-28 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/1 108 179 .. 1 74 [] 104.8 1.2e-28 PF00076.12.ls 1/1 108 179 .. 1 74 [] 106.8 6e-29 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 1, from 108 to 179: score 104.8, E = 1.2e-28 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l V +L+ +tte+dL++ Fsk+Gpi ++ iv+D ++ rs+GfaFV fj08031 108 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYD--QQSRRSRGFAFV 152 eFedeedAekAldalnGkelggrelrv<-* Fe+ +dA++A++ nG+el+gr++rv fj08031 153 YFENVDDAKEAKERANGMELDGRRIRV 179 PF00076.12.ls: domain 1 of 1, from 108 to 179: score 106.8, E = 6e-29 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l V +L+ +tte+dL++ Fsk+Gpi ++ iv+D ++ rs+GfaFV fj08031 108 LGVFGLSLYTTERDLREVFSKYGPIADVSIVYD--QQSRRSRGFAFV 152 eFedeedAekAldalnGkelggrelrv<-* Fe+ +dA++A++ nG+el+gr++rv fj08031 153 YFENVDDAKEAKERANGMELDGRRIRV 179 //