hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-09552576/chunk_1/iprscan-20080810-09552576.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj08803 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00610.11.ls Domain found in Dishevelled, Egl-10, and Ple 116.3 8.3e-32 1 PF00610.11.fs Domain found in Dishevelled, Egl-10, and Ple 114.4 3.1e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00610.11.fs 1/1 160 232 .. 1 80 [] 114.4 3.1e-31 PF00610.11.ls 1/1 160 232 .. 1 80 [] 116.3 8.3e-32 Alignments of top-scoring domains: PF00610.11.fs: domain 1 of 1, from 160 to 232: score 114.4, E = 3.1e-31 *->pesgvklkdrkwlkkvipncFtGselVdWLmdnlsgiidrkeAlhla p+sg+ ++dr+wlk++i n+ +G+++VdWL +++g ++r+eA+++a fj08803 160 PDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYA 206 qlLlkeGyirhvgdhltgkndhtFldkqtyYrf<-* ++Llk+G++rh +n+ tF++ q+yY+f fj08803 207 SSLLKHGFLRHT------VNKITFSE-QCYYVF 232 PF00610.11.ls: domain 1 of 1, from 160 to 232: score 116.3, E = 8.3e-32 *->pesgvklkdrkwlkkvipncFtGselVdWLmdnlsgiidrkeAlhla p+sg+ ++dr+wlk++i n+ +G+++VdWL +++g ++r+eA+++a fj08803 160 PDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYA 206 qlLlkeGyirhvgdhltgkndhtFldkqtyYrf<-* ++Llk+G++rh +n+ tF++ q+yY+f fj08803 207 SSLLKHGFLRHT------VNKITFSE-QCYYVF 232 //