hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-10022255/chunk_1/iprscan-20080810-10022255.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj08835 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00076.12.ls RNA recognition motif. (a.k.a. RRM, RBD, or 214.5 2.2e-61 2 PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or 210.6 3.2e-60 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00076.12.fs 1/2 47 116 .. 1 74 [] 101.8 8.8e-28 PF00076.12.ls 1/2 47 116 .. 1 74 [] 103.7 5e-28 PF00076.12.fs 2/2 146 217 .. 1 74 [] 108.9 9.1e-30 PF00076.12.ls 2/2 146 217 .. 1 74 [] 110.8 3.6e-30 Alignments of top-scoring domains: PF00076.12.fs: domain 1 of 2, from 47 to 116: score 101.8, E = 8.8e-28 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l+VgNL++d+te+ + +lFs++Gp +++k++ D t + +++FV fj08835 47 LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD----TAGNDPYCFV 89 eFedeedAekAldalnGkelggrelrv<-* eF+ ++ A++Al+a+nG++++g+e++v fj08835 90 EFHEHRHAAAALAAMNGRKIMGKEVKV 116 PF00076.12.ls: domain 1 of 2, from 47 to 116: score 103.7, E = 5e-28 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV l+VgNL++d+te+ + +lFs++Gp +++k++ D t + +++FV fj08835 47 LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD----TAGNDPYCFV 89 eFedeedAekAldalnGkelggrelrv<-* eF+ ++ A++Al+a+nG++++g+e++v fj08835 90 EFHEHRHAAAALAAMNGRKIMGKEVKV 116 PF00076.12.fs: domain 2 of 2, from 146 to 217: score 108.9, E = 9.1e-30 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fVg+L+p++t ed+k++F++fG+i ++++v+D ++tg+skG++FV fj08835 146 VFVGDLSPEITTEDIKAAFAPFGRISDARVVKD--MATGKSKGYGFV 190 eFedeedAekAldalnGkelggrelrv<-* F ++ dAe A++++ G+ lggr +r+ fj08835 191 SFFNKWDAENAIQQMGGQWLGGRQIRT 217 PF00076.12.ls: domain 2 of 2, from 146 to 217: score 110.8, E = 3.6e-30 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fVg+L+p++t ed+k++F++fG+i ++++v+D ++tg+skG++FV fj08835 146 VFVGDLSPEITTEDIKAAFAPFGRISDARVVKD--MATGKSKGYGFV 190 eFedeedAekAldalnGkelggrelrv<-* F ++ dAe A++++ G+ lggr +r+ fj08835 191 SFFNKWDAENAIQQMGGQWLGGRQIRT 217 //