hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090416/iprscan-20090416-15184299/chunk_1/iprscan-20090416-15184299.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj09834 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00462 119.7 3.3e-31 1 SM00326 61.0 1.5e-13 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00462 1/1 134 271 .. 1 156 [] 119.7 3.3e-31 SM00326 1/1 608 663 .. 1 58 [] 61.0 1.5e-13 Alignments of top-scoring domains: SM00462: domain 1 of 1, from 134 to 271: score 119.7, E = 3.3e-31 *->segvsfeVkYLGsvevpearkSlapgkglqvlqeairklr....sek s+ +++V++L ++ +++++ + +++ irkl+ + ++k fj09834 134 SDISQYRVEHLTTFVLDRKD-------AMITVDDGIRKLKlldaKGK 173 kkpqkvilsvSsdgvklidektkqvlaehplrrIsfcaadpqrwntGgdg ++q++il+v +++v+lid ++k++l ++pl++I +c a + + fj09834 174 VWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVM--------H 215 stdddrvFgyiardpgssgSnrgtsrfaCHVFrcekaaaedialaigqaF s+++d+v+++++++p++ ++ +H+F+c++++a+ i+++i a+ fj09834 216 SCSYDSVLALVCKEPTQN-------KPDLHLFQCDEVKANLISEDIESAI 258 qvayelklkarse<-* + k+k+r++ fj09834 259 SDSKGGKQKRRPD 271 SM00326: domain 1 of 1, from 608 to 663: score 61.0, E = 1.5e-13 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG +y++ +YD+ a+n ELs+ k+Di+++l++ Ww++++ +G G fj09834 608 KYAKSKYDFVARNNSELSVLKDDILEILDD-RKQWWKVRNA-SGDSG 652 lfPsnYVeeie<-* ++P n + +++ fj09834 653 FVPNNILDIVR 663 //