hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-15013808/chunk_1/iprscan-20090525-15013808.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj12172 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00339 224.7 8.2e-63 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00339 1/1 236 326 .. 1 99 [] 224.7 8.2e-63 Alignments of top-scoring domains: SM00339: domain 1 of 1, from 236 to 326: score 224.7, E = 8.2e-63 *->neKPPySYiaLIamAIlsSPekrLTLseIYkwImdnFPYYrenkasn +eKPP+SY+aLI+mAI++SPekrLTL++IY++Im+nFPYYrenk+ fj12172 236 YEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQ-- 280 sagWqvNSIRHNLSLNdcFvKvprdkegdrpgKGsyWtldPdaeedmfen gWq NSIRHNLSLN+cFvKvpr + d+pgKG+yW+ldP++ d+f+ fj12172 281 --GWQ-NSIRHNLSLNKCFVKVPR--HYDDPGKGNYWMLDPSSD-DVFIG 324 gs<-* g+ fj12172 325 GT 326 //