hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-13580721/chunk_1/iprscan-20080810-13580721.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj13355 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00273 145.9 4.2e-39 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00273 1/1 96 221 .. 1 137 [] 145.9 4.2e-39 Alignments of top-scoring domains: SM00273: domain 1 of 1, from 96 to 221: score 145.9, E = 4.2e-39 *->sdlevkVrkATnndewgpkgkhlreIlqgTsneklrssfaeimavlw s + + V+kAT+++ +gpk+khl++++q+T++ + + ++++++ l+ fj13355 96 SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMN--VNIPQLADSLF 140 rRLndkgknWrvvyKaLillhyLlrnGspfervvlealrnrnrIltLsdf +R +++ +W+vv+K+Li++h+L+ G+ ++++++l++rn++++Ls+f fj13355 141 ERTTNS--SWVVVFKSLITTHHLMVYGN---ERFIQYLASRNTLFNLSNF 185 qdkvfndidsrgkDqGaniRtyakyLlelledderlkeer<-* dk ++ +g+D++ +iR+y++yL+e++ +++ ++++ fj13355 186 LDK----SGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDF 221 //