hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-10105822/chunk_1/iprscan-20090618-10105822.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj13840 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00413 200.9 1.2e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00413 1/1 16 101 .. 1 90 [] 200.9 1.2e-55 Alignments of top-scoring domains: SM00413: domain 1 of 1, from 16 to 101: score 200.9, E = 1.2e-55 *->qiqLWqFLleLLldpennsdiIrWtdrsgGeFklvdpeeEVARLWGq i+LWqFLl+LLld+++ +++I+Wt+++g eFkl+++ee VA+LWG fj13840 16 AITLWQFLLQLLLDQKH-EHLICWTSNDG-EFKLLKAEE-VAKLWGL 59 rKgNkpnMNYeKLSRALRyYYkknIlrKVeGkrlvYkFvkdpl<-* rK Nk+nMNY+KLSRALRyYY+knI++KV G+++vYkFv+ p+ fj13840 60 RK-NKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPE 101 //