hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080810/iprscan-20080810-17064910/chunk_1/iprscan-20080810-17064910.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fj15819
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00647                                                 145.7    4.8e-39   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00647    1/2      33    95 ..     1    78 []    98.1    1e-24
SM00647    2/2     103   165 ..     1    78 []    47.6  1.7e-09

Alignments of top-scoring domains:
SM00647: domain 1 of 2, from 33 to 95: score 98.1, E = 1e-24
                   *->ekYerlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgasd
                      ekY+r+l+++yves+ +l  CP++dC+++irv+              
     fj15819    33    EKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQ-------------- 65   

                   eegcnrvtCprkCgfsFCfrCkvewHspvsC<-*
                   e+  +rv+C   C+++FCf+C++ +H+p++C   
     fj15819    66 EPRARRVQCN-RCNEVFCFKCRQMYHAPTDC    95   

SM00647: domain 2 of 2, from 103 to 165: score 47.6, E = 1.7e-09
                   *->ekY.erlllesyvesnpdlkwCPapdCsaairvtelstsrsaisgas
                       k+ ++ ++ +y+    ++k CP  +C+ +i++              
     fj15819   103    TKCaDDSETANYISA--HTKDCP--KCNICIEKN------------- 132  

                   deegcnrvtCprkCgfsFCfrCkvew..Hspv..sC<-*
                     +gcn+++C+ kC++ FC++C+ +w++H+     C   
     fj15819   133 --GGCNHMQCS-KCKHDFCWMCLGDWktHGSEyyEC    165  

//