hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080810/iprscan-20080810-18105525/chunk_1/iprscan-20080810-18105525.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fj16937
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00336                                                  42.1    7.5e-08   1
SM00184                                                  36.5    3.6e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00184    1/1      46   211 ..     1    23 []    36.5  3.6e-06
SM00336    1/1     247   288 ..     1    51 []    42.1  7.5e-08

Alignments of top-scoring domains:
SM00184: domain 1 of 1, from 46 to 211: score 36.5, E = 3.6e-06
                   *->CpICle....pvvlpCgH.FCr.Ci......................
                      C+ICl+  ++pv + CgH+FCr+C+++ +++++++++++++++++++
     fj16937    46    CAICLDyfkdPVSISCGHnFCRgCVtqlwskedeedqneeedeweee 92   

                   ..................................................
                   ++++  +  ++++++ ++   +++ +++  +++++++ + ++++ +++++
     fj16937    93 edeeavgamdgwdgsirevlyrgnadeelfqdqdddelwlgdsgitnwdn 142  

                   ..................................................
                    +  ++++++++++++   ++ +++ + +  ++++  +  +++++++  +
     fj16937   143 vdymwdeeeeeeedqdyylgglrpdlridvyreeeileaydededeelyp 192  

                   ...............CPlC<-*
                   + +++++ + +++ +CP+C   
     fj16937   193 dihpppslplpgqftCPQC    211  

SM00336: domain 1 of 1, from 247 to 288: score 42.1, E = 7.5e-08
                   *->eraplCeeHgdeepaeffCveedgallCrdCdeageHqanklfrgHr
                        + +C  H+  e +++fC e d +++C++C+e++ H      + H 
     fj16937   247    NDQGMCFKHQ--EALKLFC-EVDKEAICVVCRESRSH------KQHS 284  

                   vvll<-*
                   v +l   
     fj16937   285 VLPL    288  

//