hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080810/iprscan-20080810-19154522/chunk_1/iprscan-20080810-19154522.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fj18320
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00367                                                  52.5    5.5e-11   5
SM00256                                                  45.7      6e-09   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00256    1/1     107   147 ..     1    41 []    45.7    6e-09
SM00367    1/5     212   236 ..     1    26 []     7.8       73
SM00367    2/5     237   261 ..     1    26 []    15.8      6.2
SM00367    3/5     262   291 ..     1    26 []    12.2       20
SM00367    4/5     316   341 ..     1    26 []     9.8       41
SM00367    5/5     342   366 ..     1    26 []     7.0       94

Alignments of top-scoring domains:
SM00256: domain 1 of 1, from 107 to 147: score 45.7, E = 6e-09
                   *->LPieileeIlskLdpkdllrlrkVsrkwrslidshdfwfkr<-*
                      LP+e+l+ I+s+L + +ll+++ V+++w++l +++++w+ +   
     fj18320   107    LPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTL    147  

SM00367: domain 1 of 5, from 212 to 236: score 7.8, E = 73
                   *->CpnLkeLdLsgCsniTDeglqaLakg<-*
                      C +L+ L+L g + ++D  ++ Lak+   
     fj18320   212    CSKLQNLSLEGLR-LSDPIVNTLAKN    236  

SM00367: domain 2 of 5, from 237 to 261: score 15.8, E = 6.2
                   *->CpnLkeLdLsgCsniTDeglqaLakg<-*
                        nL +L+LsgCs  +  +lq L ++   
     fj18320   237    -SNLVRLNLSGCSGFSEFALQTLLSS    261  

SM00367: domain 3 of 5, from 262 to 291: score 12.2, E = 20
                   *->CpnLkeLdLsgCsniTD....eglqaLakg<-*
                      C +L eL+Ls+C   T ++ ++++ +++     
     fj18320   262    CSRLDELNLSWCFDFTEkhvqVAVAHVSET    291  

SM00367: domain 4 of 5, from 316 to 341: score 9.8, E = 41
                   *->CpnLkeLdLsgCsniTDeglqaLakg<-*
                      CpnL +LdLs+ + + +  +q++ ++   
     fj18320   316    CPNLVHLDLSDSVMLKNDCFQEFFQL    341  

SM00367: domain 5 of 5, from 342 to 366: score 7.0, E = 94
                   *->CpnLkeLdLsgCsniTDeglqaLakg<-*
                        +L++L+Ls+C+ i  e+l +L+     
     fj18320   342    -NYLQHLSLSRCYDIIPETLLELGEI    366  

//