hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-19531744/chunk_1/iprscan-20080810-19531744.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj19808 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00595.14.fs PDZ domain (Also known as DHR or GLGF) 84.9 3.3e-23 1 PF00595.14.ls PDZ domain (Also known as DHR or GLGF) 86.8 6.1e-23 1 PF02828.7.fs L27 domain 76.8 5.5e-21 1 PF02828.7.ls L27 domain 78.8 1.5e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02828.7.fs 1/1 15 70 .. 1 56 [] 76.8 5.5e-21 PF02828.7.ls 1/1 15 70 .. 1 56 [] 78.8 1.5e-20 PF00595.14.fs 1/1 95 174 .. 1 86 [] 84.9 3.3e-23 PF00595.14.ls 1/1 95 174 .. 1 86 [] 86.8 6.1e-23 Alignments of top-scoring domains: PF02828.7.fs: domain 1 of 1, from 15 to 70: score 76.8, E = 5.5e-21 *->avqralelLeeLqslleaseedlaeLrkiLqsphlqsLlevHDkvae + +ra+elLe+Lq+++e+++++l++L+++Lqs+++ +++ev+++v+e fj19808 15 DICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYE 61 kvydppspe<-* +v++++spe fj19808 62 TVDISSSPE 70 PF02828.7.ls: domain 1 of 1, from 15 to 70: score 78.8, E = 1.5e-20 *->avqralelLeeLqslleaseedlaeLrkiLqsphlqsLlevHDkvae + +ra+elLe+Lq+++e+++++l++L+++Lqs+++ +++ev+++v+e fj19808 15 DICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYE 61 kvydppspe<-* +v++++spe fj19808 62 TVDISSSPE 70 PF00595.14.fs: domain 1 of 1, from 95 to 174: score 84.9, E = 3.3e-23 *->evtlekedkrgglGfsikggsdkgadkgifvsevlpGsgaAeagGrL v l+k + +glGf+i gg+++ +i++s+++pG g A++ G L fj19808 95 VVELPK--TEEGLGFNIMGGKEQN--SPIYISRIIPG-GIADRHGGL 136 qaGDqIlsvNGqdlenlsheeavlalkgsggsevtLtvl<-* + GDq+lsvNG+++e+ he+av++lk + g +v+L+v+ fj19808 137 KRGDQLLSVNGVSVEGEHHEKAVELLKAAQG-KVKLVVR 174 PF00595.14.ls: domain 1 of 1, from 95 to 174: score 86.8, E = 6.1e-23 *->evtlekedkrgglGfsikggsdkgadkgifvsevlpGsgaAeagGrL v l+k + +glGf+i gg+++ +i++s+++pG g A++ G L fj19808 95 VVELPK--TEEGLGFNIMGGKEQN--SPIYISRIIPG-GIADRHGGL 136 qaGDqIlsvNGqdlenlsheeavlalkgsggsevtLtvl<-* + GDq+lsvNG+++e+ he+av++lk + g +v+L+v+ fj19808 137 KRGDQLLSVNGVSVEGEHHEKAVELLKAAQG-KVKLVVR 174 //