hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-20434411/chunk_1/iprscan-20080810-20434411.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fj21264 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01344.15.fs Kelch motif 161.9 1.5e-45 6 PF01344.15.ls Kelch motif 155.9 9.8e-44 6 PF00651.21.fs BTB/POZ domain 104.9 8.8e-29 4 PF07646.5.ls Kelch motif 90.8 4e-24 5 PF00651.21.ls BTB/POZ domain 88.2 2.3e-23 1 PF07646.5.fs Kelch motif 83.2 7.4e-22 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07646.5.ls 1/5 110 155 .. 1 54 [] 14.8 0.29 PF01344.15.ls 1/6 110 155 .. 1 45 [] 35.3 1.9e-07 PF01344.15.fs 1/6 110 150 .. 1 40 [. 34.8 4.7e-09 PF01344.15.ls 2/6 160 212 .. 1 45 [] 23.5 0.00069 PF07646.5.ls 2/5 160 212 .. 1 54 [] 30.1 7.3e-06 PF07646.5.fs 2/6 160 212 .. 1 54 [] 28.1 8.9e-07 PF01344.15.fs 2/6 160 207 .. 1 40 [. 27.8 4.5e-07 PF01344.15.ls 3/6 217 265 .. 1 45 [] 18.8 0.018 PF01344.15.fs 3/6 217 246 .. 1 29 [. 20.8 4.4e-05 PF01344.15.ls 4/6 270 315 .. 1 45 [] 26.7 7.6e-05 PF01344.15.fs 4/6 270 315 .. 1 45 [] 24.7 3.5e-06 PF01344.15.fs 5/6 326 371 .. 1 45 [] 38.3 4.6e-10 PF07646.5.ls 5/5 326 371 .. 1 54 [] 28.4 2.3e-05 PF01344.15.ls 5/6 326 371 .. 1 45 [] 40.3 6e-09 PF07646.5.fs 5/6 326 371 .. 1 54 [] 26.5 2.3e-06 PF01344.15.ls 6/6 430 471 .. 1 45 [] 11.2 0.2 PF01344.15.fs 6/6 430 460 .. 1 31 [. 15.5 0.0014 PF00651.21.fs 3/4 698 807 .. 1 135 [] 86.5 1.2e-23 PF00651.21.ls 1/1 698 807 .. 1 135 [] 88.2 2.3e-23 Alignments of top-scoring domains: PF07646.5.ls: domain 1 of 5, from 110 to 155: score 14.8, E = 0.29 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW +r+ h++v + + +yv+GG ng ++dll++d ++ +W fj21264 110 RRSKHTVVAYKDAIYVFGGD--------NGKTMLNDLLRFDVKDCSW 148 eklpalp<-* ++ + fj21264 149 CRAFTTG 155 PF01344.15.ls: domain 1 of 6, from 110 to 155: score 35.3, E = 1.9e-07 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< +Rs ++vv++++ iYv+GG +g++ ln+ ++D+++ +W++ + + fj21264 110 RRSKHTVVAYKDAIYVFGGDNGkTMLNDLLRFDVKDCSWCRAFTTG 155 -* fj21264 - - PF01344.15.fs: domain 1 of 6, from 110 to 150: score 34.8, E = 4.7e-09 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtk<-* +Rs ++vv++++ iYv+GG +g++ ln+ ++D+++ +W++ fj21264 110 RRSKHTVVAYKDAIYVFGGDNGkTMLNDLLRFDVKDCSWCR 150 PF01344.15.ls: domain 2 of 6, from 160 to 212: score 23.5, E = 0.00069 *->pRsgagvvvldgkiYviGGydg........qslnsvevYDpetntWt pR+++++vv++ ++v+GGy+g+ ++++ n+ + Y t++Wt fj21264 160 PRYHHSAVVYGSSMFVFGGYTGdiysnsnlKNKNDLFEYKFATGQWT 206 klpsmp<-* + + fj21264 207 EWKIEG 212 PF07646.5.ls: domain 2 of 5, from 160 to 212: score 30.1, E = 7.3e-06 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW pry+h++vv+g+ ++v+GG+ g ++ + +dl ++++ t +W fj21264 160 PRYHHSAVVYGSSMFVFGGY-TGDIYSNSNLKNKNDLFEYKFATGQW 205 eklpalp<-* ++ + + fj21264 206 TEWKIEG 212 PF07646.5.fs: domain 2 of 6, from 160 to 212: score 28.1, E = 8.9e-07 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW pry+h++vv+g+ ++v+GG+ g ++ + +dl ++++ t +W fj21264 160 PRYHHSAVVYGSSMFVFGGY-TGDIYSNSNLKNKNDLFEYKFATGQW 205 eklpalp<-* ++ + + fj21264 206 TEWKIEG 212 PF01344.15.fs: domain 2 of 6, from 160 to 207: score 27.8, E = 4.5e-07 *->pRsgagvvvldgkiYviGGydg........qslnsvevYDpetntWt pR+++++vv++ ++v+GGy+g+ ++++ n+ + Y t++Wt fj21264 160 PRYHHSAVVYGSSMFVFGGYTGdiysnsnlKNKNDLFEYKFATGQWT 206 k<-* + fj21264 207 E 207 PF01344.15.ls: domain 3 of 6, from 217 to 265: score 18.8, E = 0.018 *->pRsgagvvvldgkiYviGGydg.qslnsvevY...DpetntWtklps +Rs +g++v+ +k++++ Gydg+ +ln+ + + +D e +W++++ fj21264 217 ARSAHGATVYSDKLWIFAGYDGnARLNDMWTIglqDRELTCWEEVAQ 263 mp<-* + fj21264 264 SG 265 PF01344.15.fs: domain 3 of 6, from 217 to 246: score 20.8, E = 4.4e-05 *->pRsgagvvvldgkiYviGGydg.qslnsve<-* +Rs +g++v+ +k++++ Gydg+ +ln+ + fj21264 217 ARSAHGATVYSDKLWIFAGYDGnARLNDMW 246 PF01344.15.ls: domain 4 of 6, from 270 to 315: score 26.7, E = 7.6e-05 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< ++++ v+v+ +k++v+ G++g ++n+ + + +++tWt++p+ fj21264 270 SCCNFPVAVCRDKMFVFSGQSGaKITNNLFQFEFKDKTWTRIPTEH 315 -* fj21264 - - PF01344.15.fs: domain 4 of 6, from 270 to 315: score 24.7, E = 3.5e-06 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< ++++ v+v+ +k++v+ G++g ++n+ + + +++tWt++p+ fj21264 270 SCCNFPVAVCRDKMFVFSGQSGaKITNNLFQFEFKDKTWTRIPTEH 315 -* fj21264 - - PF01344.15.fs: domain 5 of 6, from 326 to 371: score 38.3, E = 4.6e-10 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< +R+g+++v++d ++Yv+GG +++ n +YD++ +tW+ + + + fj21264 326 RRYGHTMVAFDRHLYVFGGAADnTLPNELHCYDVDFQTWEVVQPSS 371 -* fj21264 - - PF07646.5.ls: domain 5 of 5, from 326 to 371: score 28.4, E = 2.3e-05 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW +ry+h++v + lyv+GG+ ++ +++ l+++d + ++W fj21264 326 RRYGHTMVAFDRHLYVFGGA--------ADNTLPNELHCYDVDFQTW 364 eklpalp<-* e +++ fj21264 365 EVVQPSS 371 PF01344.15.ls: domain 5 of 6, from 326 to 371: score 40.3, E = 6e-09 *->pRsgagvvvldgkiYviGGydg.qslnsvevYDpetntWtklpsmp< +R+g+++v++d ++Yv+GG +++ n +YD++ +tW+ + + + fj21264 326 RRYGHTMVAFDRHLYVFGGAADnTLPNELHCYDVDFQTWEVVQPSS 371 -* fj21264 - - PF07646.5.fs: domain 5 of 6, from 326 to 371: score 26.5, E = 2.3e-06 *->pryphasvvpggklyvvGGsfkgnrgtgngdesssdllvldpetnvW +ry+h++v + lyv+GG+ ++ +++ l+++d + ++W fj21264 326 RRYGHTMVAFDRHLYVFGGA--------ADNTLPNELHCYDVDFQTW 364 eklpalp<-* e +++ fj21264 365 EVVQPSS 371 PF01344.15.ls: domain 6 of 6, from 430 to 471: score 11.2, E = 0.2 *->pRsgagvvvldgkiYviGGydgqslnsvevYDpetntWtklpsmp<- R +++++v+ + +Y++GG ++ +s e+Y + p + fj21264 430 GRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQ---FSCYPKCT 471 * fj21264 - - PF01344.15.fs: domain 6 of 6, from 430 to 460: score 15.5, E = 0.0014 *->pRsgagvvvldgkiYviGGydgqslnsvevY<-* R +++++v+ + +Y++GG ++ +s e+Y fj21264 430 GRLFHAAAVISDAMYIFGGTVDNNIRSGEMY 460 PF00651.21.fs: domain 3 of 4, from 698 to 807: score 86.5, E = 1.2e-23 *->lnelrkqg..elcDVtLvvgdgsgrydvgkkfkAHKavLaacSpYFk +++ ++ + e+cD+tL+ + g+ +AHKa+Laa+S+YF fj21264 698 MKAYLEGAgaEFCDITLLLD--------GHPRPAHKAILAARSSYFE 736 alFtgqfkesiteeessvsseieledvspe..dfealLefiYtgelsitq a+F + + e ++ i + ++ p++++fe +L++iY ge++++ fj21264 737 AMFRSF------MPEDGQV-NISIGEMVPSrqAFESMLRYIYYGEVNMP- 778 dqksPssckseenvedlLaaAadllqipslvdaCeefliksl<-* +e+ +l+aa ++ + + +++++l fj21264 779 ----------PEDSLYLFAAP-YYYGFYN--NRLQAYCKQNL 807 PF00651.21.ls: domain 1 of 1, from 698 to 807: score 88.2, E = 2.3e-23 *->lnelrkqg..elcDVtLvvgdgsgrydvgkkfkAHKavLaacSpYFk +++ ++ + e+cD+tL+ + g+ +AHKa+Laa+S+YF fj21264 698 MKAYLEGAgaEFCDITLLLD--------GHPRPAHKAILAARSSYFE 736 alFtgqfkesiteeessvsseieledvspe..dfealLefiYtgelsitq a+F + + e ++ i + ++ p++++fe +L++iY ge++++ fj21264 737 AMFRSF------MPEDGQV-NISIGEMVPSrqAFESMLRYIYYGEVNMP- 778 dqksPssckseenvedlLaaAadllqipslvdaCeefliksl<-* +e+ +l+aa ++ + + +++++l fj21264 779 ----------PEDSLYLFAAP-YYYGFYN--NRLQAYCKQNL 807 //