hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-21313921/chunk_1/iprscan-20080810-21313921.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk00081 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF03712.5.fs Copper type II ascorbate-dependent mon 80.5 9.7e-24 1 PF03712.5.ls Copper type II ascorbate-dependent mon 77.1 5e-20 1 PF01082.10.fs Copper type II ascorbate-dependent mon 40.0 7.4e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01082.10.fs 1/1 3 53 .. 101 152 .] 40.0 7.4e-12 PF03712.5.fs 1/1 68 217 .. 1 152 [. 80.5 9.7e-24 PF03712.5.ls 1/1 68 232 .. 1 173 [] 77.1 5e-20 Alignments of top-scoring domains: PF01082.10.fs: domain 1 of 1, from 3 to 53: score 40.0, E = 7.4e-12 *->scskILyAWArnApptvLPkeVGlriGgkgsikYLVLQVHYghapsf +c+++++AWA + + +P+ VGl++G + + Y+ L+VHY ++p fk00081 3 TCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPHYVLLEVHY-DNPTY 48 qdgek<-* ++g + fk00081 49 EEGLI 53 PF03712.5.fs: domain 1 of 1, from 68 to 217: score 80.5, E = 9.7e-24 *->kfvAGImglyLlmspdfaIPpgetafnldisCkynetksALP...es k++AG+ + +L s IPpg f +++ C+ + AL +++s fk00081 68 KYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEaekPS 114 GIhpFAYRvHaHgLGrVvtGyrvRtnsDGngkwheIGkgdPqyPPHfQaF GIh+FA +HaH+ Gr + +R gk+ + d fQ+F fk00081 115 GIHVFAVLLHAHLAGRGIRLRHFR-----KGKEMKLLAYDDDFDFNFQEF 159 YpvknvveVkpGDiLAtrCtYdttkrtkaTsiGaTinDEMCNfYiMYYtd + +k ++ pGD L+t C Y+t++r++ T +G EMC Y+ YY+ fk00081 160 QYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPR 209 ssvelpys<-* ++ + s fk00081 210 INLTRCAS 217 PF03712.5.ls: domain 1 of 1, from 68 to 232: score 77.1, E = 5e-20 *->kfvAGImglyLlmspdfaIPpgetafnldisCkynetksALP...es k++AG+ + +L s IPpg f +++ C+ + AL +++s fk00081 68 KYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEaekPS 114 GIhpFAYRvHaHgLGrVvtGyrvRtnsDGngkwheIGkgdPqyPPHfQaF GIh+FA +HaH+ Gr + +R gk+ + d fQ+F fk00081 115 GIHVFAVLLHAHLAGRGIRLRHFR-----KGKEMKLLAYDDDFDFNFQEF 159 YpvknvveVkpGDiLAtrCtYdttkrtkaTsiGaTinDEMCNfYiMYYtd + +k ++ pGD L+t C Y+t++r++ T +G EMC Y+ YY+ fk00081 160 QYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPR 209 ssvelpysacsgdflpkyFgsnfpsdvsv<-* ++ + s +++ ++ F +v++ fk00081 210 INLTRCAS-IPDIMEQLQF-----IGVKE 232 //