hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080810/iprscan-20080810-21431510/chunk_1/iprscan-20080810-21431510.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk00223
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00248                                                  40.6    2.2e-07   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00248    1/2      70    99 ..     1    30 []    19.1     0.63
SM00248    2/2     142   171 ..     1    30 []    21.5     0.12

Alignments of top-scoring domains:
SM00248: domain 1 of 2, from 70 to 99: score 19.1, E = 0.63
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                       Gr++L +A+en nle+++lLl++++ + +   
     fk00223    70    LGRSALLIAIENENLEIMELLLNHSVYVGD    99   

SM00248: domain 2 of 2, from 142 to 171: score 21.5, E = 0.12
                   *->dGrTpLHlAaengnlevvklLldkgadina<-*
                       + Tp++lAa ++n+e++klL++k ++i     
     fk00223   142    PDITPIMLAAHTNNYEIIKLLVQKRVTIPR    171  

//