hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-21551507/chunk_1/iprscan-20080810-21551507.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk00416 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00560.23.ls Leucine Rich Repeat 49.4 1.1e-11 4 PF00560.23.fs Leucine Rich Repeat 45.3 2.4e-11 5 PF07647.7.fs SAM domain (Sterile alpha motif) 33.7 3.1e-09 1 PF07647.7.ls SAM domain (Sterile alpha motif) 34.0 4.7e-07 1 PF00536.20.fs SAM domain (Sterile alpha motif) 23.6 2.7e-06 1 PF00536.20.ls SAM domain (Sterile alpha motif) 25.5 0.00017 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00560.23.fs 2/5 90 111 .. 1 24 [] 14.1 0.0082 PF00560.23.ls 1/4 90 111 .. 1 24 [] 16.0 0.13 PF00560.23.ls 2/4 113 134 .. 1 24 [] 10.3 3.2 PF00560.23.ls 3/4 136 157 .. 1 24 [] 10.6 2.8 PF00560.23.ls 4/4 159 177 .. 1 24 [] 12.6 1.1 PF00536.20.fs 1/1 575 638 .. 1 65 [] 23.6 2.7e-06 PF00536.20.ls 1/1 575 638 .. 1 65 [] 25.5 0.00017 PF07647.7.ls 1/1 575 640 .. 1 72 [] 34.0 4.7e-07 PF07647.7.fs 1/1 581 640 .. 8 72 .] 33.7 3.1e-09 Alignments of top-scoring domains: PF00560.23.fs: domain 2 of 5, from 90 to 111: score 14.1, E = 0.0082 *->nLeeLdLsgCNpsltgslpssl.nl<-* ++++LdL++ N +lt lp++l+ l fk00416 90 TIKVLDLHD-N-QLT-ALPDDLgQL 111 PF00560.23.ls: domain 1 of 4, from 90 to 111: score 16.0, E = 0.13 *->nLeeLdLsgCNpsltgslpssl.nl<-* ++++LdL++ N +lt lp++l+ l fk00416 90 TIKVLDLHD-N-QLT-ALPDDLgQL 111 PF00560.23.ls: domain 2 of 4, from 113 to 134: score 10.3, E = 3.2 *->nLeeLdLsgCNpsltgslpssl.nl<-* L++L++++ N +l lp s++nl fk00416 113 ALQVLNVER-N-QLM-QLPRSIgNL 134 PF00560.23.ls: domain 3 of 4, from 136 to 157: score 10.6, E = 2.8 *->nLeeLdLsgCNpsltgslpssl.nl<-* +L++L++ + N +l ++lp+ ++ l fk00416 136 QLQTLNVKD-N-KL-KELPDTVgEL 157 PF00560.23.ls: domain 4 of 4, from 159 to 177: score 12.6, E = 1.1 *->nLeeLdLsgCNpsltgslpsslnl<-* +L++L++sg N ++ lp l fk00416 159 SLRTLNISG-N-EIQ-RLPQ--ML 177 PF00536.20.fs: domain 1 of 1, from 575 to 638: score 23.6, E = 2.7e-06 *->dgwsfesVgeWLesiglgqYidnFlsagyidgdtllqlteeDLedlG ++ +++ Le++ ++Y F ++++ ++d l+q+++ DL ++G fk00416 575 EEGMERQLVALLEELSAEHYLPIF-AHHRLSLDLLSQMSPGDLAKVG 620 vtllGHrkKIlssIqgLk<-* v +G ++ Il+++q L fk00416 621 VSEAGLQHEILRRVQELL 638 PF00536.20.ls: domain 1 of 1, from 575 to 638: score 25.5, E = 0.00017 *->dgwsfesVgeWLesiglgqYidnFlsagyidgdtllqlteeDLedlG ++ +++ Le++ ++Y F ++++ ++d l+q+++ DL ++G fk00416 575 EEGMERQLVALLEELSAEHYLPIF-AHHRLSLDLLSQMSPGDLAKVG 620 vtllGHrkKIlssIqgLk<-* v +G ++ Il+++q L fk00416 621 VSEAGLQHEILRRVQELL 638 PF07647.7.ls: domain 1 of 1, from 575 to 640: score 34.0, E = 4.7e-07 *->veswslesvaeWLesiglegqYkdnFsdqgitglellllrlteedLa +e ++ + Le++ ++Y ++F + ++ +ll +++ dL fk00416 575 EEGMER-QLVALLEELSA-EHYLPIFAHHRLSL-DLL-SQMSPGDL- 616 klalGitsvghRkkilkkiqelkqq<-* + + G++ +g +++il+ +qel++ fk00416 617 A-KVGVSEAGLQHEILRRVQELLDA 640 PF07647.7.fs: domain 1 of 1, from 581 to 640: score 33.7, E = 3.1e-09 *->svaeWLesiglegqYkdnFsdqgitglellllrlteedLaklalGit ++ + Le++ ++Y ++F + ++ +ll +++ dL + + G++ fk00416 581 QLVALLEELSA-EHYLPIFAHHRLSL-DLL-SQMSPGDL-A-KVGVS 622 svghRkkilkkiqelkqq<-* +g +++il+ +qel++ fk00416 623 EAGLQHEILRRVQELLDA 640 //