hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-23003799/chunk_1/iprscan-20080810-23003799.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk01315 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00170.11.fs bZIP transcription factor 50.8 8.9e-14 1 PF00170.11.ls bZIP transcription factor 52.8 1.1e-12 1 PF07716.5.fs Basic region leucine zipper 48.0 4.2e-12 1 PF07716.5.ls Basic region leucine zipper 49.9 7.9e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00170.11.fs 1/1 232 297 .. 1 65 [] 50.8 8.9e-14 PF00170.11.ls 1/1 232 297 .. 1 65 [] 52.8 1.1e-12 PF07716.5.fs 1/1 233 287 .. 1 57 [] 48.0 4.2e-12 PF07716.5.ls 1/1 233 287 .. 1 57 [] 49.9 7.9e-12 Alignments of top-scoring domains: PF00170.11.fs: domain 1 of 1, from 232 to 297: score 50.8, E = 8.9e-14 *->ekelKrerR.kqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLr e +++r r+ +++NR AA+r+R++++ + Le k+eeL+ N++L fk01315 232 EDPDERRRKfLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQ 278 kelerLkkevakLksenee<-* e+++Lk+eva+Lk+ + + fk01315 279 NEVSMLKNEVAQLKQLLLT 297 PF00170.11.ls: domain 1 of 1, from 232 to 297: score 52.8, E = 1.1e-12 *->ekelKrerR.kqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLr e +++r r+ +++NR AA+r+R++++ + Le k+eeL+ N++L fk01315 232 EDPDERRRKfLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQ 278 kelerLkkevakLksenee<-* e+++Lk+eva+Lk+ + + fk01315 279 NEVSMLKNEVAQLKQLLLT 297 PF07716.5.fs: domain 1 of 1, from 233 to 287: score 48.0, E = 4.2e-12 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk ++de+r++ +rN++AA r+R+K+K + le++++eL++ N+qL fk01315 233 DPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQL-- 277 rqkveqLekE<-* +++v++L++E fk01315 278 QNEVSMLKNE 287 PF07716.5.ls: domain 1 of 1, from 233 to 287: score 49.9, E = 7.9e-12 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk ++de+r++ +rN++AA r+R+K+K + le++++eL++ N+qL fk01315 233 DPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQL-- 277 rqkveqLekE<-* +++v++L++E fk01315 278 QNEVSMLKNE 287 //