hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080810/iprscan-20080810-23003799/chunk_1/iprscan-20080810-23003799.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk01315
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00338                                                  83.7    2.2e-20   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00338    1/1     233   297 ..     1    65 []    83.7  2.2e-20

Alignments of top-scoring domains:
SM00338: domain 1 of 1, from 233 to 297: score 83.7, E = 2.2e-20
                   *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk
                      ++de+rr+ +erNR+AA+r+R+++k ++  Le+k+eeL++ N++L++
     fk01315   233    DPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQN 279  

                   eleqLrreleklkselee<-*
                   e++ L++e+++lk++l +   
     fk01315   280 EVSMLKNEVAQLKQLLLT    297  

//