hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080810/iprscan-20080810-23305190/chunk_1/iprscan-20080810-23305190.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk01593 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00521 133.2 2.7e-35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00521 1/1 273 334 .. 1 62 [] 133.2 2.7e-35 Alignments of top-scoring domains: SM00521: domain 1 of 1, from 273 to 334: score 133.2, E = 2.7e-35 *->aeeePlyVNaKQYhrIlrRRqaRakleaelklikerkkYLHeSRhkH eeePlyVNaKQYhrIl+RRqaRakleae+k++ker+kYLHeSRh+H fk01593 273 LEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRH 319 AlrRpRgsGGRFlna<-* A+ R+Rg+GGRF++ fk01593 320 AMARKRGEGGRFFSP 334 //