hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-02341349/chunk_1/iprscan-20080811-02341349.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk04727 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00057.9.fs Low-density lipoprotein receptor domain 527.5 7.1e-170 8 PF00057.9.ls Low-density lipoprotein receptor domain 543.0 2.8e-160 8 PF07645.6.fs Calcium binding EGF domain 55.6 4e-16 5 PF00008.17.ls EGF-like domain 55.7 1.4e-13 4 PF00008.17.fs EGF-like domain 50.7 2.6e-13 6 PF07645.6.ls Calcium binding EGF domain 45.0 2.3e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00057.9.fs 1/8 88 124 .. 1 40 [] 72.5 9.2e-23 PF00057.9.ls 1/8 88 124 .. 1 40 [] 74.4 3.3e-19 PF00057.9.ls 2/8 127 165 .. 1 40 [] 71.6 2.3e-18 PF00057.9.fs 2/8 127 165 .. 1 40 [] 69.6 7.7e-22 PF00057.9.fs 3/8 168 206 .. 1 40 [] 55.2 3.7e-17 PF00057.9.ls 3/8 168 206 .. 1 40 [] 57.1 5.3e-14 PF00057.9.ls 4/8 209 245 .. 1 40 [] 65.9 1.2e-16 PF00057.9.fs 4/8 209 245 .. 1 40 [] 64.0 5.1e-20 PF00057.9.fs 5/8 248 286 .. 1 40 [] 70.6 3.7e-22 PF00057.9.ls 5/8 248 286 .. 1 40 [] 72.6 1.2e-18 PF00057.9.ls 6/8 294 330 .. 1 40 [] 73.8 5.2e-19 PF00057.9.fs 6/8 294 330 .. 1 40 [] 71.8 1.5e-22 PF00057.9.fs 7/8 333 369 .. 1 40 [] 64.2 4.3e-20 PF00057.9.ls 7/8 333 369 .. 1 40 [] 66.1 1e-16 PF00057.9.fs 8/8 373 412 .. 1 40 [] 59.5 1.5e-18 PF00057.9.ls 8/8 373 412 .. 1 40 [] 61.5 2.6e-15 PF00008.17.ls 3/4 417 451 .. 1 38 [] 34.3 4e-07 PF00008.17.fs 5/6 417 451 .. 1 38 [] 32.4 3.6e-08 PF07645.6.fs 5/5 453 491 .. 1 55 [] 43.3 2.2e-12 PF07645.6.ls 1/1 453 491 .. 1 55 [] 45.0 2.3e-10 Alignments of top-scoring domains: PF00057.9.fs: domain 1 of 8, from 88 to 124: score 72.5, E = 9.2e-23 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +C+p +FqC +gr CI +w+CDGd DC DgSDE +nC fk04727 88 AKCEPSQFQCTNGR-CITLLWKCDGDEDCVDGSDE--KNC 124 PF00057.9.ls: domain 1 of 8, from 88 to 124: score 74.4, E = 3.3e-19 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +C+p +FqC +gr CI +w+CDGd DC DgSDE +nC fk04727 88 AKCEPSQFQCTNGR-CITLLWKCDGDEDCVDGSDE--KNC 124 PF00057.9.ls: domain 2 of 8, from 127 to 165: score 71.6, E = 2.3e-18 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tC++ +F C++g+ C+p++w+CDGdpDCeDgSDEs+e+C fk04727 127 KTCAESDFVCNNGQ-CVPSRWKCDGDPDCEDGSDESPEQC 165 PF00057.9.fs: domain 2 of 8, from 127 to 165: score 69.6, E = 7.7e-22 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tC++ +F C++g+ C+p++w+CDGdpDCeDgSDEs+e+C fk04727 127 KTCAESDFVCNNGQ-CVPSRWKCDGDPDCEDGSDESPEQC 165 PF00057.9.fs: domain 3 of 8, from 168 to 206: score 55.2, E = 3.7e-17 *->stCgpdeFqCgsgr.rCIprswvCDGdpDCeDgSDEslenC<-* +tC+ +e +Cg ++++CIp sw+CDG++DC+ g+DE enC fk04727 168 RTCRIHEISCGAHStQCIPVSWRCDGENDCDSGEDE--ENC 206 PF00057.9.ls: domain 3 of 8, from 168 to 206: score 57.1, E = 5.3e-14 *->stCgpdeFqCgsgr.rCIprswvCDGdpDCeDgSDEslenC<-* +tC+ +e +Cg ++++CIp sw+CDG++DC+ g+DE enC fk04727 168 RTCRIHEISCGAHStQCIPVSWRCDGENDCDSGEDE--ENC 206 PF00057.9.ls: domain 4 of 8, from 209 to 245: score 65.9, E = 1.2e-16 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* tC+pdeF+C+sgr CI+r +vC+G++DC DgSDE +C fk04727 209 ITCSPDEFTCSSGR-CISRNFVCNGQDDCSDGSDE--LDC 245 PF00057.9.fs: domain 4 of 8, from 209 to 245: score 64.0, E = 5.1e-20 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* tC+pdeF+C+sgr CI+r +vC+G++DC DgSDE +C fk04727 209 ITCSPDEFTCSSGR-CISRNFVCNGQDDCSDGSDE--LDC 245 PF00057.9.fs: domain 5 of 8, from 248 to 286: score 70.6, E = 3.7e-22 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tCg++eFqC++++ CIp+swvCD d+DC D+SDEsle+C fk04727 248 PTCGAHEFQCSTSS-CIPISWVCDDDADCSDQSDESLEQC 286 PF00057.9.ls: domain 5 of 8, from 248 to 286: score 72.6, E = 1.2e-18 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tCg++eFqC++++ CIp+swvCD d+DC D+SDEsle+C fk04727 248 PTCGAHEFQCSTSS-CIPISWVCDDDADCSDQSDESLEQC 286 PF00057.9.ls: domain 6 of 8, from 294 to 330: score 73.8, E = 5.2e-19 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* ++C + e qCgsg+ CI+++w+CDGdpDC+DgSDE +nC fk04727 294 TKCPASEIQCGSGE-CIHKKWRCDGDPDCKDGSDE--VNC 330 PF00057.9.fs: domain 6 of 8, from 294 to 330: score 71.8, E = 1.5e-22 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* ++C + e qCgsg+ CI+++w+CDGdpDC+DgSDE +nC fk04727 294 TKCPASEIQCGSGE-CIHKKWRCDGDPDCKDGSDE--VNC 330 PF00057.9.fs: domain 7 of 8, from 333 to 369: score 64.2, E = 4.3e-20 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tC+pd+F C++g+ CI+ s++C+G +DC DgSDE +nC fk04727 333 RTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDE--VNC 369 PF00057.9.ls: domain 7 of 8, from 333 to 369: score 66.1, E = 1e-16 *->stCgpdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* +tC+pd+F C++g+ CI+ s++C+G +DC DgSDE +nC fk04727 333 RTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDE--VNC 369 PF00057.9.fs: domain 8 of 8, from 373 to 412: score 59.5, E = 1.5e-18 *->stCg.pdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* ++C +p++F+C+sg+ CI +s+vC++++DC+D+SDE+l+ C fk04727 373 NQCLgPGKFKCRSGE-CIDISKVCNQEQDCRDWSDEPLKEC 412 PF00057.9.ls: domain 8 of 8, from 373 to 412: score 61.5, E = 2.6e-15 *->stCg.pdeFqCgsgrrCIprswvCDGdpDCeDgSDEslenC<-* ++C +p++F+C+sg+ CI +s+vC++++DC+D+SDE+l+ C fk04727 373 NQCLgPGKFKCRSGE-CIDISKVCNQEQDCRDWSDEPLKEC 412 PF00008.17.ls: domain 3 of 4, from 417 to 451: score 34.3, E = 4e-07 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C nng+Cs+ +C d+ gy+C+C+ G f l + k+C fk04727 417 CLVNNGGCSH--ICKDLVIGYECDCAAG-FELIDRKTC 451 PF00008.17.fs: domain 5 of 6, from 417 to 451: score 32.4, E = 3.6e-08 *->CspnngpCsngGtCvdtpggytCeCppGyfllytGkrC<-* C nng+Cs+ +C d+ gy+C+C+ G f l + k+C fk04727 417 CLVNNGGCSH--ICKDLVIGYECDCAAG-FELIDRKTC 451 PF07645.6.fs: domain 5 of 5, from 453 to 491: score 43.3, E = 2.2e-12 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +++ +C + +C+N +G+++C+ C++GY+ fk04727 453 DIDECQNPG--IC-----SQICINLKGGYKCE----CSRGYQ----- 483 nnedgtnC<-* ++C fk04727 484 MDLATGVC 491 PF07645.6.ls: domain 1 of 1, from 453 to 491: score 45.0, E = 2.3e-10 *->DvDECadgtlhnCdDpdantvCvNtiGSFeCvarkdCpeGYeVpvse D+DEC +++ +C + +C+N +G+++C+ C++GY+ fk04727 453 DIDECQNPG--IC-----SQICINLKGGYKCE----CSRGYQ----- 483 nnedgtnC<-* ++C fk04727 484 MDLATGVC 491 //