hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-11481850/chunk_1/iprscan-20090618-11481850.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk04732 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02257.6.fs RFX DNA-binding domain 190.9 1.8e-58 1 PF02257.6.ls RFX DNA-binding domain 192.8 7.3e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02257.6.fs 1/1 106 188 .. 1 84 [] 190.9 1.8e-58 PF02257.6.ls 1/1 106 188 .. 1 84 [] 192.8 7.3e-55 PF02178.9.ls 1/1 493 505 .. 1 13 [] 11.4 0.23 Alignments of top-scoring domains: PF02257.6.fs: domain 1 of 1, from 106 to 188: score 190.9, E = 1.8e-58 *->ddaseqNresnrqvfPAtlqWLkenyEeqedvclPRsklYahYlkhC d++se++++sn+++++ +++W+++++Ee++d+clP++++Y++Y+k+C fk04732 106 DKSSEPSTLSNEEYMY-AYRWIRNHLEEHTDTCLPKQSVYDAYRKYC 151 eslaClkPlnaASFGKLIRsvFpdLkTRRLGtRGqSK<-* eslaC++Pl++A+FGK+IR++Fpd+k+RRLG+RGqSK fk04732 152 ESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSK 188 PF02257.6.ls: domain 1 of 1, from 106 to 188: score 192.8, E = 7.3e-55 *->ddaseqNresnrqvfPAtlqWLkenyEeqedvclPRsklYahYlkhC d++se++++sn+++++ +++W+++++Ee++d+clP++++Y++Y+k+C fk04732 106 DKSSEPSTLSNEEYMY-AYRWIRNHLEEHTDTCLPKQSVYDAYRKYC 151 eslaClkPlnaASFGKLIRsvFpdLkTRRLGtRGqSK<-* eslaC++Pl++A+FGK+IR++Fpd+k+RRLG+RGqSK fk04732 152 ESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSK 188 PF02178.9.ls: domain 1 of 1, from 493 to 505: score 11.4, E = 0.23 *->kRkRGRPrKaata<-* kRkRGRPrK+++ fk04732 493 KRKRGRPRKKSGG 505 //