hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-02591677/chunk_1/iprscan-20080811-02591677.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk04920 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00589 105.6 5.7e-27 1 SM00336 43.1 3.7e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00336 1/1 43 84 .. 1 51 [] 43.1 3.7e-08 SM00589 1/1 247 300 .. 1 56 [] 105.6 5.7e-27 Alignments of top-scoring domains: SM00336: domain 1 of 1, from 43 to 84: score 43.1, E = 3.7e-08 *->eraplCeeHgdeepaeffCveedgallCrdCdeageHqanklfrgHr + + lC++H+ e + +fC ed+++ C++C + +H r H+ fk04920 43 RDESLCPQHH--EALSLFC-YEDQEAVCLICAISHTH------RAHT 80 vvll<-* vv+l fk04920 81 VVPL 84 SM00589: domain 1 of 1, from 247 to 300: score 105.6, E = 5.7e-27 *->avdvtLDPdTAhpkLlLSeDrrsVrygdtkqkGsnlpdnPeRFdsyp +dvtLDP+TAhp+L+LSeDr+sV++ +t+ + +lpd+P+RF++yp fk04920 247 IADVTLDPETAHPNLVLSEDRKSVKFVETRLR--DLPDTPRRFTFYP 291 cVLGsegFs<-* cVL+ egF+ fk04920 292 CVLATEGFT 300 //