hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/Pfam.bin
Sequence file:            /db/iprscan/tmp/20090525/iprscan-20090525-15262831/chunk_1/iprscan-20090525-15262831.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk05554
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00096.16.ls Zinc finger, C2H2 type                         158.6    1.5e-44   5
PF00096.16.fs Zinc finger, C2H2 type                         148.8    1.4e-41   5
PF01352.17.fs KRAB box                                        70.2    2.8e-19   1
PF01352.17.ls KRAB box                                        72.2    1.5e-18   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF01352.17.fs   1/1     202   242 ..     1    41 []    70.2  2.8e-19
PF01352.17.ls   1/1     202   242 ..     1    41 []    72.2  1.5e-18
PF00096.16.ls   1/5     522   544 ..     1    24 []    31.1  3.5e-06
PF00096.16.fs   1/5     522   544 ..     1    24 []    29.2  5.1e-06
PF00096.16.ls   2/5     550   572 ..     1    24 []    24.1  0.00045
PF00096.16.ls   3/5     578   600 ..     1    24 []    33.1  8.7e-07
PF00096.16.fs   3/5     578   600 ..     1    24 []    31.2  1.6e-06
PF00096.16.ls   4/5     606   628 ..     1    24 []    35.5  1.7e-07
PF00096.16.fs   4/5     606   628 ..     1    24 []    33.5  4.2e-07
PF00096.16.fs   5/5     634   656 ..     1    24 []    32.7  6.6e-07
PF00096.16.ls   5/5     634   656 ..     1    24 []    34.7    3e-07

Alignments of top-scoring domains:
PF01352.17.fs: domain 1 of 1, from 202 to 242: score 70.2, E = 2.8e-19
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      VtF D+aV+F+++EW+ Ld++Q++LY++ + ENy++L+Sl+   
     fk05554   202    VTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLD    242  

PF01352.17.ls: domain 1 of 1, from 202 to 242: score 72.2, E = 1.5e-18
                   *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-*
                      VtF D+aV+F+++EW+ Ld++Q++LY++ + ENy++L+Sl+   
     fk05554   202    VTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLD    242  

PF00096.16.ls: domain 1 of 5, from 522 to 544: score 31.1, E = 3.5e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+Cp +CgksF  +++L  H r+H   
     fk05554   522    YSCP-ECGKSFGVRKSLIIHHRSH    544  

PF00096.16.fs: domain 1 of 5, from 522 to 544: score 29.2, E = 5.1e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+Cp +CgksF  +++L  H r+H   
     fk05554   522    YSCP-ECGKSFGVRKSLIIHHRSH    544  

PF00096.16.ls: domain 2 of 5, from 550 to 572: score 24.1, E = 0.00045
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C  +C ksF+ +s L rH++tH   
     fk05554   550    YECA-ECEKSFNCHSGLIRHQMTH    572  

PF00096.16.ls: domain 3 of 5, from 578 to 600: score 33.1, E = 8.7e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ykC+ +C k++srk++L++H+r H   
     fk05554   578    YKCS-ECEKTYSRKEHLQNHQRLH    600  

PF00096.16.fs: domain 3 of 5, from 578 to 600: score 31.2, E = 1.6e-06
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ykC+ +C k++srk++L++H+r H   
     fk05554   578    YKCS-ECEKTYSRKEHLQNHQRLH    600  

PF00096.16.ls: domain 4 of 5, from 606 to 628: score 35.5, E = 1.7e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C   CgksF rk nL +H+r+H   
     fk05554   606    FQCA-LCGKSFIRKQNLLKHQRIH    628  

PF00096.16.fs: domain 4 of 5, from 606 to 628: score 33.5, E = 4.2e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      ++C   CgksF rk nL +H+r+H   
     fk05554   606    FQCA-LCGKSFIRKQNLLKHQRIH    628  

PF00096.16.fs: domain 5 of 5, from 634 to 656: score 32.7, E = 6.6e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C  +CgksF+ k++Lk Hlr+H   
     fk05554   634    YTCG-ECGKSFRYKESLKDHLRVH    656  

PF00096.16.ls: domain 5 of 5, from 634 to 656: score 34.7, E = 3e-07
                   *->ykCpfdCgksFsrksnLkrHlrtH<-*
                      y+C  +CgksF+ k++Lk Hlr+H   
     fk05554   634    YTCG-ECGKSFRYKESLKDHLRVH    656  

//