hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20090618/iprscan-20090618-12334597/chunk_1/iprscan-20090618-12334597.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: fk06583
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00326                                                  95.2    7.7e-24   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00326    1/1     505   560 .]     1    58 []    95.2  7.7e-24

Alignments of top-scoring domains:
SM00326: domain 1 of 1, from 505 to 560: score 95.2, E = 7.7e-24
                   *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG
                       ++vAlYDy+a ++dE+sF ++Diit +e +ddgWw+G ++  G+ G
     fk06583   505    ITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCK--GRYG 549  

                   lfPsnYVeeie<-*
                   lfP+nYVe+ +   
     fk06583   550 LFPANYVELRQ    560  

//