hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-04275396/chunk_1/iprscan-20080811-04275396.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk07131 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04433.7.ls SWIRM domain 157.8 2.7e-44 1 PF04433.7.fs SWIRM domain 155.8 1e-43 1 PF00249.21.fs Myb-like DNA-binding domain 45.4 1.9e-11 1 PF00249.21.ls Myb-like DNA-binding domain 47.1 5.4e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04433.7.fs 1/1 429 517 .. 1 95 [] 155.8 1e-43 PF04433.7.ls 1/1 429 517 .. 1 95 [] 157.8 2.7e-44 PF00249.21.fs 1/1 633 678 .. 1 65 [] 45.4 1.9e-11 PF00249.21.ls 1/1 633 678 .. 1 65 [] 47.1 5.4e-11 Alignments of top-scoring domains: PF04433.7.fs: domain 1 of 1, from 429 to 517: score 155.8, E = 1e-43 *->lkeasyaswldlsaltpiEllsepEfflgktlsgrktpevYLviRns ++++sya+w+d++ ++ iE++ +pEff+gk +++ktpe YL++Rn+ fk07131 429 IIIPSYAAWFDYNSVHAIERRALPEFFNGK--NKSKTPEIYLAYRNF 473 iislwrlnptkyltktdarrnlagpfnsDvnlvsrvydFLerwGyINy<- +i+++rlnp++ylt t++rrnlag Dv++++rv++FLe+wG+INy fk07131 474 MIDTYRLNPQEYLTSTACRRNLAG----DVCAIMRVHAFLEQWGLINY 517 * fk07131 - - PF04433.7.ls: domain 1 of 1, from 429 to 517: score 157.8, E = 2.7e-44 *->lkeasyaswldlsaltpiEllsepEfflgktlsgrktpevYLviRns ++++sya+w+d++ ++ iE++ +pEff+gk +++ktpe YL++Rn+ fk07131 429 IIIPSYAAWFDYNSVHAIERRALPEFFNGK--NKSKTPEIYLAYRNF 473 iislwrlnptkyltktdarrnlagpfnsDvnlvsrvydFLerwGyINy<- +i+++rlnp++ylt t++rrnlag Dv++++rv++FLe+wG+INy fk07131 474 MIDTYRLNPQEYLTSTACRRNLAG----DVCAIMRVHAFLEQWGLINY 517 * fk07131 - - PF00249.21.fs: domain 1 of 1, from 633 to 678: score 45.4, E = 1.9e-11 *->rgrWtaeEdellveavekhGkgfgIrlsltkanWkkIaeklgpgssn + +Wt++E+ ll+ea+e++ + W+k++e++g fk07131 633 TREWTEQETLLLLEALEMYKDD-----------WNKVSEHVG----- 663 nvlgrtaeqcklryykyk<-* +rt +c+l+++++ fk07131 664 ---SRTQDECILHFLRLP 678 PF00249.21.ls: domain 1 of 1, from 633 to 678: score 47.1, E = 5.4e-11 *->rgrWtaeEdellveavekhGkgfgIrlsltkanWkkIaeklgpgssn + +Wt++E+ ll+ea+e++ + W+k++e++g fk07131 633 TREWTEQETLLLLEALEMYKDD-----------WNKVSEHVG----- 663 nvlgrtaeqcklryykyk<-* +rt +c+l+++++ fk07131 664 ---SRTQDECILHFLRLP 678 //