hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-04443514/chunk_1/iprscan-20080811-04443514.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk07246 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02257.6.fs RFX DNA-binding domain 200.0 2.7e-61 1 PF02257.6.ls RFX DNA-binding domain 202.0 1.3e-57 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02257.6.fs 1/1 135 217 .. 1 84 [] 200.0 2.7e-61 PF02257.6.ls 1/1 135 217 .. 1 84 [] 202.0 1.3e-57 Alignments of top-scoring domains: PF02257.6.fs: domain 1 of 1, from 135 to 217: score 200.0, E = 2.7e-61 *->ddaseqNresnrqvfPAtlqWLkenyEeqedvclPRsklYahYlkhC +++e+Nr+s+++++PAtlqWL+enyE++e+vc+PRs+lY+hYl++C fk07246 135 NEEKENNRASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFC 181 eslaClkPlnaASFGKLIRsvFpdLkTRRLGtRGqSK<-* e+++ ++P+naASFGK+IR++Fp+L+TRRLGtRGqSK fk07246 182 EKND-TQPVNAASFGKIIRQQFPQLTTRRLGTRGQSK 217 PF02257.6.ls: domain 1 of 1, from 135 to 217: score 202.0, E = 1.3e-57 *->ddaseqNresnrqvfPAtlqWLkenyEeqedvclPRsklYahYlkhC +++e+Nr+s+++++PAtlqWL+enyE++e+vc+PRs+lY+hYl++C fk07246 135 NEEKENNRASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFC 181 eslaClkPlnaASFGKLIRsvFpdLkTRRLGtRGqSK<-* e+++ ++P+naASFGK+IR++Fp+L+TRRLGtRGqSK fk07246 182 EKND-TQPVNAASFGKIIRQQFPQLTTRRLGTRGQSK 217 //