hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-05073933/chunk_1/iprscan-20080811-05073933.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk07692 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00449 123.6 2.2e-32 1 SM00502 67.5 1.7e-15 1 SM00336 43.7 2.4e-08 1 SM00060 38.6 8.4e-07 1 SM00184 36.3 4.1e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00184 1/1 26 75 .. 1 23 [] 36.3 4.1e-06 SM00336 1/1 130 180 .. 1 51 [] 43.7 2.4e-08 SM00502 1/1 197 323 .. 1 132 [] 67.5 1.7e-15 SM00060 1/1 360 450 .. 1 69 [] 38.6 8.4e-07 SM00449 1/1 516 635 .. 1 145 [] 123.6 2.2e-32 Alignments of top-scoring domains: SM00184: domain 1 of 1, from 26 to 75: score 36.3, E = 4.1e-06 *->CpICle....pvvlpCgH.FCr.Ci.....................C CpICle ++p +lpC H+ C++C ++ ++ ++++ ++ + +C fk07692 26 CPICLElfedPLLLPCAHsLCFnCAhrilvshcatnesvesitafqC 72 PlC<-* P+C fk07692 73 PTC 75 SM00336: domain 1 of 1, from 130 to 180: score 43.7, E = 2.4e-08 *->eraplCeeHgd..eepaeffCveedgallCrdCdeageHqanklfrg ++++lC+++++++ + a+ C +++++++C++C a +H+++k+f g fk07692 130 AEKVLCQFCDQdpAQDAVKTC-VTCEVSYCDECLKA-THPNKKPFTG 174 Hrvvll<-* Hr + fk07692 175 HRLIEP 180 SM00502: domain 1 of 1, from 197 to 323: score 67.5, E = 1.7e-15 *->qreaLeelleklrkkaeelekalkqldsiiqevegGqvdenaeevea ++ Le++l++l k++ ele l++l++ +q+ve na + ea fk07692 197 EKQNLESNLTNLIKRNTELETLLAKLIQTCQHVE-----VNASRQEA 238 eikaafdeLrnaLnerkkqLledLeevkenklkkLeqQlesltqkqekle ++++++d L++++++r++ + +++e k ++l+kL qQ+ ++ q+ e+ fk07692 239 KLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIANCKQCIERSA 288 hainfaeeaLnsgdptelLlskkliierlqellkq<-* ++i++ae+ L+++d +++L+ k+i+er+ ++ + fk07692 289 SLISQAEHSLKENDHARFLQTAKNITERVSMATAS 323 SM00060: domain 1 of 1, from 360 to 450: score 38.6, E = 8.4e-07 *->PgpPsnptelrvtdvtststsdltsvtlsWepP....ivgYr..... P pP+ ++ + + ++t++W+ ++ ++v+Y+ + + fk07692 360 PNPPTIR--EELCTASYD------TITVHWTSDdefsVVSYElqyti 398 ...........................ytltgLkPgaepwteYefrVrAv +++ ++++ ++ +++ +++ +++ yt++gL+ g t+Y f V+A+ fk07692 399 ftgqanvvslcnsadswmivpnikqnhYTVHGLQSG----TKYIFMVKAI 444 ngndaGeg<-* n aG+ fk07692 445 NQ--AGSR 450 SM00449: domain 1 of 1, from 516 to 635: score 123.6, E = 2.2e-32 *->sGkhYfEVevdtggdkghwrvGvatksvhlypfkvrrkrkggvsllG sG+hY+EV + ++++ +G+a+ks+ ++ +++G fk07692 516 SGRHYWEVVISGSTW---YAIGLAYKSA------------PKHEWIG 547 edkgSwgyrgdggkkyhasefgeeyglpfqepgDviGcflDleaggStis ++ Sw+++ ++ +++ +++++e++ ++ ++ +++G++lD+++g +i fk07692 548 KNSASWALCRCN-NNWVVRHNSKEIPIEPAPHLRRVGILLDYDNG--SIA 594 FykNGkyLgdshilaffdvtfsgpLyPavslgstdgGgesvrlnfGp.p< Fy + + + l++fdv f +p++P++++++ ++ + ++ p p fk07692 595 FYDALNSIH----LYTFDVAFAQPVCPTFTVWN----KCLTIITGLPiP 635 -* fk07692 - - //