hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-07372305/chunk_1/iprscan-20080811-07372305.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk09725 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00150 151.8 6.9e-41 3 SM00054 42.3 6.3e-08 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00150 1/3 174 275 .. 1 104 [] 94.8 9.9e-24 SM00150 2/3 289 396 .. 1 104 [] 50.4 2.4e-10 SM00150 3/3 410 509 .. 1 104 [] 6.6 2.2 SM00054 1/2 527 555 .. 1 29 [] 17.4 1.1 SM00054 2/2 563 591 .. 1 29 [] 25.0 0.011 Alignments of top-scoring domains: SM00150: domain 1 of 3, from 174 to 275: score 94.8, E = 9.9e-24 *->qqFlrdadeleaWleekeqllssedlgeskDlesveallkkHqalea ++F ++a e W keq+l ++d+ es +l++v+all+kH+a+e fk09725 174 EKFRQKASTHETWAYGKEQILLQKDY-ESASLTEVRALLRKHEAFES 219 elaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlelae +laah++rv+++ + +++L e +da ++ +r++++ ++W++L l++ fk09725 220 DLAAHQDRVEQIAAIAQELNEL-DYHDAVNVNDRCQKICDQWDRLGTLTQ 268 eRrqkLe<-* +Rr++Le fk09725 269 KRREALE 275 SM00150: domain 2 of 3, from 289 to 396: score 50.4, E = 2.4e-10 *->qqFlrdadeleaWleekeqllssedlgeskDlesveallkkHqalea +F + a+ + +W+e +++ l+++ + +++e++++l+ H++++a fk09725 289 LEFAKRAAPFNNWMEGAMEDLQDMFIV--HSIEEIQSLITAHEQFKA 333 el...aaheervdalnelgeqLiee...sghpdaeeIeerleelnerWee l++ + ++++ a++++ e+ i++ + ++ ++el+++W++ fk09725 334 TLpeaDGERQSIMAIQNEVEKVIQSyniRISSSNPYSTVTMDELRTKWDK 383 LlelaeeRrqkLe<-* +++l+ R q L+ fk09725 384 VKQLVPIRDQSLQ 396 SM00150: domain 3 of 3, from 410 to 509: score 6.6, E = 2.2 *->qqFlrdadeleaWleekeqllssedlgeskDlesveallkkHqalea +qF + a+ + W+++k++ + + + ++e+++ ++++ e+ fk09725 410 RQFAAQANAIGPWIQNKMEEIARSSI---QITGALEDQMNQLKQYEH 453 elaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlelae + ++++ +d+l+ qLi+e+ +d ++ +e+++ We Ll + fk09725 454 NIINYKNNIDKLEGD-HQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIA 502 eRrqkLe<-* + + e fk09725 503 RTINEVE 509 SM00054: domain 1 of 2, from 527 to 555: score 17.4, E = 1.1 *->elkeaFrefDkDgdGkIdfeEfkallksl<-* e+++ F++fD+ ++G d e+f+a+l s+ fk09725 527 EFRASFNHFDRRKNGLMDHEDFRACLISM 555 SM00054: domain 2 of 2, from 563 to 591: score 25.0, E = 0.011 *->elkeaFrefDkDgdGkIdfeEfkallksl<-* e+ +++ ++D +g G+++f+ f++++++ fk09725 563 EFARIMTLVDPNGQGTVTFQSFIDFMTRE 591 //