hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090618/iprscan-20090618-12410119/chunk_1/iprscan-20090618-12410119.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk09741 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00295 275.0 5.9e-78 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00295 1/1 217 412 .. 1 232 [] 275.0 5.9e-78 Alignments of top-scoring domains: SM00295: domain 1 of 1, from 217 to 412: score 275.0, E = 5.9e-78 *->spkprvlkVylldgttlefevdssttaeelletvcrklglspresey + k++ +kV+lldgt +++ +++++++++l+++vc++l+l +e++y fk09741 217 KTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNL--LEKDY 261 FgLqfedkdedshWldpaktilkqdvkspksepltlyFRvkFyppdwhgp FgL f e++ Wldpak+i++q ++ +p+ + F vkFyppd fk09741 262 FGLLFQESPEQKNWLDPAKEIKRQLRN----LPWLFTFNVKFYPPD---- 303 peqlkeDptrynllylQvrddilsGrlpcpseeeallLAaLalqaefGdy p+ql+eD+try +l+lQ+r+di sGrlpc+ + +++lL+++ lqae+Gdy fk09741 304 PSQLTEDITRY-FLCLQLRQDIASGRLPCS-FVTHALLGSYTLQAELGDY 351 dpeeeekkkslkhvakelslkrflPkqlldsikasflqiqltlkewrerI dpe +h +++ls+++f P q +ke++e++ fk09741 352 DPE--------EHGSIDLSEFQFAPTQ---------------TKELEEKV 378 velhkehaglspeeaklkYLelarrLpptYGvelF<-* +elhk h+glsp++a+ ++Le+a+rL +YGv+l+ fk09741 379 AELHKTHRGLSPAQADSQFLENAKRLS-MYGVDLH 412 //