hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-08182669/chunk_1/iprscan-20080811-08182669.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk09872 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00002 158.5 6.7e-43 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00002 1/1 155 215 .. 1 63 [] 158.5 6.7e-43 Alignments of top-scoring domains: SM00002: domain 1 of 1, from 155 to 215: score 158.5, E = 6.7e-43 *->NiWttCqsitsptktlttsiedlCvDaRQYGIlPWNAfPGKvCGssE NiW+tC++i+sp++++tt++e++CvD+RQYGI+PWNAfPGK+CGs fk09872 155 NIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGS-- 199 nLlsiCkTsEFnmTfH<-* +L++iC+T+EF+m++H fk09872 200 ALENICNTNEFYMSYH 215 //