hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20090525/iprscan-20090525-15394277/chunk_1/iprscan-20090525-15394277.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk09943 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00745 114.9 9.2e-30 1 SM00382 88.7 6.9e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00745 1/1 27 105 .. 1 81 [] 114.9 9.2e-30 SM00382 1/1 189 325 .. 1 92 [] 88.7 6.9e-22 Alignments of top-scoring domains: SM00745: domain 1 of 1, from 27 to 105: score 114.9, E = 9.2e-30 *->trdylqkAieliskAlkaDedvagdyeeAlelYkkgieyLlqgikve t+++lqkAi+l+skA ++D+ ag+yeeAl+lY+++++y+l+++k+e fk09943 27 TSPNLQKAIDLASKAAQEDK--AGNYEEALQLYQHAVQYFLHVVKYE 71 kpsekrrealkakareYldRAeeikkylderlkp<-* ++++k++++++ak++eYldRAe++k+yl++++k fk09943 72 AQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKK 105 SM00382: domain 1 of 1, from 189 to 325: score 88.7, E = 6.9e-22 *->pgevvllvGppGsGKTTlaralarllgp.gviyidge.........g p + +ll+GppG+GK+ la+a+a +++ + ++ i+ ++ ++ +++ fk09943 189 PWRGILLFGPPGTGKSYLAKAVATEANNsTFFSISSSdlvskwlgeS 235 gqrirlalalark...dvlllDEitslld..................... ++ ++++++lar+++++++++DEi+sl ++++++++ ++ + + + + fk09943 236 EKLVKNLFQLAREnkpSIIFIDEIDSLCGsrseneseaarrikteflvqm 285 .........vtviattn..dldpallrrrfdrrivllril<-* ++ + +++++ v+++tn + ++ ++rrrf++ri++++++ fk09943 286 qgvgvdndgILVLGATNipWVLDSAIRRRFEKRIYIPLPE 325 //