hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-09171399/chunk_1/iprscan-20080811-09171399.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk10490 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00157.8.ls Pou domain - N-terminal to homeobox domain 194.6 2.1e-55 1 PF00157.8.fs Pou domain - N-terminal to homeobox domain 192.7 8.1e-55 1 PF00046.19.ls Homeobox domain 91.6 2.2e-24 1 PF00046.19.fs Homeobox domain 89.6 8.6e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00157.8.fs 1/1 138 212 .. 1 78 [] 192.7 8.1e-55 PF00157.8.ls 1/1 138 212 .. 1 78 [] 194.6 2.1e-55 PF00046.19.fs 1/1 231 287 .. 1 57 [] 89.6 8.6e-24 PF00046.19.ls 1/1 231 287 .. 1 57 [] 91.6 2.2e-24 Alignments of top-scoring domains: PF00157.8.fs: domain 1 of 1, from 138 to 212: score 192.7, E = 8.1e-55 *->deatdleeLEkFAkeFKqRRIkLGyTQadVGlALgalygPGvnafSQ +++++ ++LE+FAk+FKqRRIkLG+TQadVGlALg+lyg n+fSQ fk10490 138 EDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG---NVFSQ 181 tTICRFEaLqLSfKNmcKLKPlLekWLeeAE<-* tTICRFEaLqLSfKNmcKLKPlL+kWLeeA+ fk10490 182 TTICRFEALQLSFKNMCKLKPLLNKWLEEAD 212 PF00157.8.ls: domain 1 of 1, from 138 to 212: score 194.6, E = 2.1e-55 *->deatdleeLEkFAkeFKqRRIkLGyTQadVGlALgalygPGvnafSQ +++++ ++LE+FAk+FKqRRIkLG+TQadVGlALg+lyg n+fSQ fk10490 138 EDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG---NVFSQ 181 tTICRFEaLqLSfKNmcKLKPlLekWLeeAE<-* tTICRFEaLqLSfKNmcKLKPlL+kWLeeA+ fk10490 182 TTICRFEALQLSFKNMCKLKPLLNKWLEEAD 212 PF00046.19.fs: domain 1 of 1, from 231 to 287: score 89.6, E = 8.6e-24 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r+kRT++ + +LE +F k+++Ps++e+ LA++L+L++++V+vW fk10490 231 RKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVW 277 FQNRRaKwKk<-* F+NRR+K+K+ fk10490 278 FCNRRQKEKR 287 PF00046.19.ls: domain 1 of 1, from 231 to 287: score 91.6, E = 2.2e-24 *->rrkRTtftpeQleeLEkeFqknrYPsreeReeLAkkLgLterqVkvW r+kRT++ + +LE +F k+++Ps++e+ LA++L+L++++V+vW fk10490 231 RKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVW 277 FQNRRaKwKk<-* F+NRR+K+K+ fk10490 278 FCNRRQKEKR 287 //