hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080811/iprscan-20080811-09533146/chunk_1/iprscan-20080811-09533146.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: fk10959 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00170.11.fs bZIP transcription factor 78.1 1.5e-21 1 PF00170.11.ls bZIP transcription factor 80.0 6.9e-21 1 PF07716.5.ls Basic region leucine zipper 26.5 8.5e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00170.11.fs 1/1 103 163 .] 1 65 [] 78.1 1.5e-21 PF00170.11.ls 1/1 103 163 .] 1 65 [] 80.0 6.9e-21 PF07716.5.ls 1/1 104 157 .. 1 57 [] 26.5 8.5e-05 Alignments of top-scoring domains: PF00170.11.fs: domain 1 of 1, from 103 to 163: score 78.1, E = 1.5e-21 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e+ +Kre+R++kNReAAr++R++K++++++Le++v++Le++Nk+L++ fk10959 103 EATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIE 149 elerLkkevakLksenee<-* el+ Lk++++ ++ e fk10959 150 ELKALKDLYC----HKVE 163 PF00170.11.ls: domain 1 of 1, from 103 to 163: score 80.0, E = 6.9e-21 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e+ +Kre+R++kNReAAr++R++K++++++Le++v++Le++Nk+L++ fk10959 103 EATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIE 149 elerLkkevakLksenee<-* el+ Lk++++ ++ e fk10959 150 ELKALKDLYC----HKVE 163 PF07716.5.ls: domain 1 of 1, from 104 to 157: score 26.5, E = 8.5e-05 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk + +++ r + +N+eAA+ +R KkK++ + le+rv Le +N +L fk10959 104 ATRKRELRLM-KNREAARECRRKKKEYVKCLENRVAVLENQNKTL-- 147 rqkveqLekE<-* +++++L++ fk10959 148 IEELKALKDL 157 //